KEGG   Schistosoma mansoni: Smp_013540Help
Entry
Smp_013540        CDS       T01095                                 

Definition
tyrosinase precursor (EC:1.10.3.-)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
smm  Schistosoma mansoni
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:smm00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:smm00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 478 aa AA seqDB search
MQHIWFIIILTFYLIIINVQCLIPKLCVNNITAIGGSGICCPIPNGSKYPCGGPGQGTCQ
KEYTQIDRIPFYLIMDDRMNWPSRFFNHFCKCENHYFGISCNECWYGWEGKFCNKRKEYI
RYNILSFSPKKRKMFVNVVTRMLTTPTDYLILFEKDAIHSDPLWKPKFLDVDVQYLFSFI
HRYASRATLFHDNIDCIIRRHLDNNHEVVGFLTWHRYYMLFWERHLRKIAIRLYGWTDFT
IPYWDWVDSTRCDVCVNSLLGGYGQWVGQTRLIDPRSPFYMWPEYCSPPTTGSNCYSCHA
GWPNFRVLTRYFESTAFPTTHNLLFTLSKDTFYLPQVKEDFDKCRGFHQALEGFCSFPGD
NSTYSFMHNKVHNVVSGTFCCAATSPNDPLFLVHHTQIDRIFQLWFMYNRPRPTDYPNHG
VALGNCRECNMVGFIPTIKHVQMFVNTKLIGYTYDNFNFGKRGFKGEKYLKCGPKYRV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatatatggtttattattattctaacattctatttaataataataaatgttcaa
tgtcttataccaaaattatgtgtaaataatattacagcaattggtggtagtggtatttgt
tgtccaatacctaatggttccaaatatccatgtggtggtccaggtcaaggtacatgtcaa
aaagaatatacacaaattgatcgtataccattttatttaattatggatgatagaatgaat
tggccatcaagattttttaatcatttttgtaaatgtgaaaatcattattttggtatttca
tgtaatgaatgttggtatggttgggaaggaaaattttgtaataaacgtaaagaatatatt
cgatataatatattatcattttctccaaaaaaaagaaaaatgtttgttaatgttgtaaca
agaatgcttactactccaacggattatttgatattatttgaaaaagatgctatacattct
gatccattatggaaacctaaatttttagatgtagatgtacaatatttattctcttttata
catcgttatgcaagcagagctacattatttcatgataatatagattgtataatacgtaga
catttggataataatcatgaagtagttggatttttaacttggcatagatattatatgtta
ttttgggaaagacatctacgtaaaattgcaattcgactgtatggttggacagatttcaca
ataccttattgggattgggttgattctacaaggtgtgatgtttgtgttaatagtttatta
ggtggttatggacaatgggttgggcaaactcgtttaatagaccctagaagtccattctac
atgtggccggaatactgttctcccccaactacgggaagtaattgttatagttgtcatgct
ggttggccaaactttcgagtattgacaagatatttcgaaagtacagcattcccaacaact
cataaccttttgttcactctttcaaaggatacgttttatttgcctcaagtgaaggaggat
tttgataaatgtcgtggttttcatcaagctcttgaaggattttgttcttttcccggtgac
aattcaacttattcatttatgcataataaagtacataatgtagtgagtggtacattttgt
tgtgcagctacttcacccaatgatcctctattcttagtacatcatacacaaattgataga
attttccaattatggtttatgtataatcgtccacgtccaacggattatccaaatcatgga
gttgcacttggaaattgtcgtgaatgtaatatggttggtttcattcctacaattaaacac
gtacaaatgtttgtaaatacaaaactaataggttatacatatgataattttaattttggt
aaacgtggcttcaagggagaaaaatacttgaaatgtggtcctaaatatcgtgtctaa

DBGET integrated database retrieval system