KEGG   Schistosoma mansoni: Smp_013540Help
Entry
Smp_013540        CDS       T01095                                 

Definition
tyrosinase precursor (EC:1.10.3.-)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
smm  Schistosoma mansoni
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smp_013540
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Smp_013540
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Smp_013540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 478 aa AA seqDB search
MQHIWFIIILTFYLIIINVQCLIPKLCVNNITAIGGSGICCPIPNGSKYPCGGPGQGTCQ
KEYTQIDRIPFYLIMDDRMNWPSRFFNHFCKCENHYFGISCNECWYGWEGKFCNKRKEYI
RYNILSFSPKKRKMFVNVVTRMLTTPTDYLILFEKDAIHSDPLWKPKFLDVDVQYLFSFI
HRYASRATLFHDNIDCIIRRHLDNNHEVVGFLTWHRYYMLFWERHLRKIAIRLYGWTDFT
IPYWDWVDSTRCDVCVNSLLGGYGQWVGQTRLIDPRSPFYMWPEYCSPPTTGSNCYSCHA
GWPNFRVLTRYFESTAFPTTHNLLFTLSKDTFYLPQVKEDFDKCRGFHQALEGFCSFPGD
NSTYSFMHNKVHNVVSGTFCCAATSPNDPLFLVHHTQIDRIFQLWFMYNRPRPTDYPNHG
VALGNCRECNMVGFIPTIKHVQMFVNTKLIGYTYDNFNFGKRGFKGEKYLKCGPKYRV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatatatggtttattattattctaacattctatttaataataataaatgttcaa
tgtcttataccaaaattatgtgtaaataatattacagcaattggtggtagtggtatttgt
tgtccaatacctaatggttccaaatatccatgtggtggtccaggtcaaggtacatgtcaa
aaagaatatacacaaattgatcgtataccattttatttaattatggatgatagaatgaat
tggccatcaagattttttaatcatttttgtaaatgtgaaaatcattattttggtatttca
tgtaatgaatgttggtatggttgggaaggaaaattttgtaataaacgtaaagaatatatt
cgatataatatattatcattttctccaaaaaaaagaaaaatgtttgttaatgttgtaaca
agaatgcttactactccaacggattatttgatattatttgaaaaagatgctatacattct
gatccattatggaaacctaaatttttagatgtagatgtacaatatttattctcttttata
catcgttatgcaagcagagctacattatttcatgataatatagattgtataatacgtaga
catttggataataatcatgaagtagttggatttttaacttggcatagatattatatgtta
ttttgggaaagacatctacgtaaaattgcaattcgactgtatggttggacagatttcaca
ataccttattgggattgggttgattctacaaggtgtgatgtttgtgttaatagtttatta
ggtggttatggacaatgggttgggcaaactcgtttaatagaccctagaagtccattctac
atgtggccggaatactgttctcccccaactacgggaagtaattgttatagttgtcatgct
ggttggccaaactttcgagtattgacaagatatttcgaaagtacagcattcccaacaact
cataaccttttgttcactctttcaaaggatacgttttatttgcctcaagtgaaggaggat
tttgataaatgtcgtggttttcatcaagctcttgaaggattttgttcttttcccggtgac
aattcaacttattcatttatgcataataaagtacataatgtagtgagtggtacattttgt
tgtgcagctacttcacccaatgatcctctattcttagtacatcatacacaaattgataga
attttccaattatggtttatgtataatcgtccacgtccaacggattatccaaatcatgga
gttgcacttggaaattgtcgtgaatgtaatatggttggtttcattcctacaattaaacac
gtacaaatgtttgtaaatacaaaactaataggttatacatatgataattttaattttggt
aaacgtggcttcaagggagaaaaatacttgaaatgtggtcctaaatatcgtgtctaa

DBGET integrated database retrieval system