KEGG   Schistosoma mansoni: Smp_015030Help
Entry
Smp_015030        CDS       T01095                                 

Definition
choline/ethanolamine kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
smm  Schistosoma mansoni
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Smp_015030
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Smp_015030
    2.7.1.82  ethanolamine kinase
     Smp_015030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 291 aa AA seqDB search
MKYIQIVGKLKGYQRIYGIFNNGFVYSYIDGNDITLEKLSDIKYGRLIAKKMAQLHCLPI
DEFIQKTQNDTLIEKSKPESQLFPTIFKWIDRLDEEFIDSSRNIKKYESIFPSKSYVLNE
VIQLKDQYLFNPISKVVLCHNDLNAANIILAPDGNSVHLIDMEYCDLNYAAYDIGNHFCE
FTGPYATEFQHYPSIEYQKEWINAYLTAYYKYSQSKLDLQLNIYKEDYINQWLKEVNCFA
LVSHLLWAVWAVICASENLRSMDFLAYADSRMKQYYNMKKWLPSTFQLPIL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattcaaatagttggcaaattaaaaggctatcaacgcatatatggaatattt
aataatggttttgtatattcctatattgatggtaatgatattacattagaaaaattatct
gatataaaatatggcaggttaattgcaaagaaaatggctcagttacattgtttacctatt
gatgaattcatccaaaaaacacaaaatgatacattaattgagaagagtaaaccagaatct
caactatttccaacaattttcaaatggatagatagacttgacgaggaattcatcgattcg
tcaaggaatattaaaaaatatgaatcaatttttccaagtaaatcttatgttttaaatgaa
gtaatccaattgaaagatcaatatctttttaatcctatatctaaagtagttttatgccat
aatgatctgaatgcagctaacattatactggctccagatggaaattctgttcacttgatt
gatatggaatattgtgacttaaactatgctgcatatgatattggtaatcacttttgtgaa
tttactggaccatatgctacagaatttcaacattatccatcaattgaatatcaaaaggaa
tggataaatgcatatttaactgcttattataaatattctcaatcaaaattagatttacaa
ttgaatatatacaaagaagattatataaatcaatggcttaaagaggttaattgttttgca
ttggtatctcatttactttgggctgtttgggcagtaatttgcgcatcggaaaacttacgt
tctatggattttctagcttatgctgattcaagaatgaaacaatattataatatgaaaaaa
tggttaccatcaacttttcaattacccattttgtaa

DBGET integrated database retrieval system