KEGG   Schistosoma mansoni: Smp_015030Help
Entry
Smp_015030        CDS       T01095                                 

Definition
(RefSeq) putative choline/ethanolamine kinase
Organism
smm  Schistosoma mansoni
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Kdo
Motif
Other DBs
NCBI-GeneID: 8347344
NCBI-ProteinID: XP_018651573
GeneDB: Smp_015030
UniProt: G4VGA6
Position
3
AA seq 291 aa AA seqDB search
MKYIQIVGKLKGYQRIYGIFNNGFVYSYIDGNDITLEKLSDIKYGRLIAKKMAQLHCLPI
DEFIQKTQNDTLIEKSKPESQLFPTIFKWIDRLDEEFIDSSRNIKKYESIFPSKSYVLNE
VIQLKDQYLFNPISKVVLCHNDLNAANIILAPDGNSVHLIDMEYCDLNYAAYDIGNHFCE
FTGPYATEFQHYPSIEYQKEWINAYLTAYYKYSQSKLDLQLNIYKEDYINQWLKEVNCFA
LVSHLLWAVWAVICASENLRSMDFLAYADSRMKQYYNMKKWLPSTFQLPIL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattcaaatagttggcaaattaaaaggctatcaacgcatatatggaatattt
aataatggttttgtatattcctatattgatggtaatgatattacattagaaaaattatct
gatataaaatatggcaggttaattgcaaagaaaatggctcagttacattgtttacctatt
gatgaattcatccaaaaaacacaaaatgatacattaattgagaagagtaaaccagaatct
caactatttccaacaattttcaaatggatagatagacttgacgaggaattcatcgattcg
tcaaggaatattaaaaaatatgaatcaatttttccaagtaaatcttatgttttaaatgaa
gtaatccaattgaaagatcaatatctttttaatcctatatctaaagtagttttatgccat
aatgatctgaatgcagctaacattatactggctccagatggaaattctgttcacttgatt
gatatggaatattgtgacttaaactatgctgcatatgatattggtaatcacttttgtgaa
tttactggaccatatgctacagaatttcaacattatccatcaattgaatatcaaaaggaa
tggataaatgcatatttaactgcttattataaatattctcaatcaaaattagatttacaa
ttgaatatatacaaagaagattatataaatcaatggcttaaagaggttaattgttttgca
ttggtatctcatttactttgggctgtttgggcagtaatttgcgcatcggaaaacttacgt
tctatggattttctagcttatgctgattcaagaatgaaacaatattataatatgaaaaaa
tggttaccatcaacttttcaattacccattttgtaa

DBGET integrated database retrieval system