KEGG   Schistosoma mansoni: Smp_018260Help
Entry
Smp_018260        CDS       T01095                                 

Definition
glycogen synthase (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
smm  Schistosoma mansoni
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Smp_018260
Enzymes [BR:smm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Smp_018260
Glycosyltransferases [BR:smm01003]
 Polysaccharide
  Storage polysaccharide
   Smp_018260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 706 aa AA seqDB search
MSTLGRRASVARYNRDSLISDDLIQSINPEVYQRKFVFEVAWEVVNKVGGIYTVIRTKAA
SAVEELGDRYILFGPLNEVCMRTEVDVTEPTNEALKRTIKAMREHGTKVVFGRWLIEGYP
NVVLFDIGSSAWRIDSWKKELWESCNIGIPVHDTECNDAVIFGALIAWFLKEVKTDPQPP
IIAHFHEWLTSIGLVFTRTRHLPVATVFTTHATLLGRYLCASSVDLYNHLSDFDLDKEAG
DRNIYHRYCLERAAVHCAHVFTTVSKITGLESKFLLRREPDIITPNGLNVVKFAALHEFQ
NRHALAKEKLNQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADIFIEALARLNHHLK
QAQTDVTVVAFLIFPAHTNSFNVDSFRAQAIVKQLRETVNSIQCEMGHRLFEVCLRGRIP
QGSDLLTQGDVFRLKRCIYATQRNNLPPICTHNVVQDNIDLVLCNLRRCQLFNDRHDRVK
VIFHPEFLSSTNPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGF
GCFIEEHVEDPKSYGIYIVDRRFQSCEDSVQQLTKYLVEFSQYSRRQRIVLRNRTERLSE
LLDWKNLSCYYQRARLMALKKFSPELFTSNNNDDALSTHSFHISRPYSAPVSPSLSGQST
PLRSAGANSSNRSSPTSHLDDDEIDDNTERLELGLGAIEITDAVPG
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactcttgggaggagagcaagtgttgctcggtataatagagactcattgatatct
gatgacttgatacaatcaataaaccctgaggtataccaacgtaaatttgttttcgaagtt
gcttgggaggtggtcaataaagttggtgggatatatactgtcatccgtactaaggccgca
tctgctgtggaggagttgggcgaccgttatattttatttggcccactcaatgaagtgtgc
atgaggactgaagtagacgttacagagccaacaaatgaggcattaaaacgcacaatcaaa
gccatgcgtgaacatggcacaaaagtcgtttttggtcgatggctaattgagggctatcca
aacgttgttctgttcgacataggatcatctgcttggcgcatcgattcttggaaaaaagaa
ctgtgggaatcttgtaatattgggattccggtccatgatactgagtgtaatgatgcagtc
atttttggagcgcttattgcctggtttctgaaagaagttaaaactgaccctcaaccacca
atcattgcacactttcatgaatggcttacaagcattggtttagtatttacgcgtactcgt
caccttcccgttgctactgtgttcactacacatgcaacacttttgggtcgttatttatgt
gcttcctctgttgatttatataaccatctttcggattttgatctagataaggaggctggc
gatcgaaatatttaccatcgttattgccttgaacgtgcagccgttcattgtgcacatgta
tttactactgtgagtaaaattactggcttggaaagtaaatttcttttgcgaagagaacca
gacatcatcactccaaatggtcttaatgttgttaaatttgctgcacttcatgaatttcaa
aatcgtcatgcgttggctaaagaaaaactgaatcaatttattcaaggacatttttatgga
cattatgattttgatttggacaaaacattgtattttttcattgctggacgttacgaattt
cagaataaaggagctgatatatttatcgaggcgctggctcgtcttaaccatcatttaaaa
caagcacaaactgatgtcactgtcgtagccttcctcatttttccagctcatacgaatagt
tttaacgtggattcgtttcgtgcccaagctattgtaaagcaactgcgtgaaacagtaaat
tcgatccaatgtgaaatgggacataggttatttgaggtgtgtcttcgaggacgtattcct
caaggatctgatctacttactcagggtgatgtatttcgccttaaacgttgtatatatgca
acacaacgaaataatttgccccctatttgtacacacaatgtcgttcaagataatattgat
ctagttctgtgtaacttacgccggtgtcagttatttaatgaccgtcatgatcgtgttaag
gttatttttcatcctgaattcttaagttctaccaatccactattaccgatggattatgaa
gaatttgtgcgaggctgtcatttaggtgtttttccatcttattatgaaccatggggttat
acaccagctgaatgcactgtaatgggtattccatcggtaacgacaaatctttctggattt
ggctgcttcatagaagagcatgtagaagatcccaaatcgtatggaatatacattgttgat
cgtcgtttccaaagctgtgaagacagtgttcaacagttaaccaagtatttggttgagttc
tctcaatattctcgtcgtcaacgtattgttttacgaaatcgtaccgagcgattaagtgaa
ctgttggattggaaaaatctttcctgttactatcaacgtgccagattaatggcattaaag
aaattctctccagaactattcacatctaacaacaatgatgatgcattatcgacccatagt
tttcatattagtcgaccatattcagcacctgtatctccatcactatctggacaatcaaca
ccgttgcgtagtgccggtgcaaatagttcaaatcgtagcagtcctacatcacatttagat
gatgatgaaattgatgataacacagaacgattagaactaggtcttggtgcaatagaaatc
actgatgctgtacctggttga

DBGET integrated database retrieval system