KEGG   Schistosoma mansoni: Smp_026420Help
Entry
Smp_026420        CDS       T01095                                 

Definition
calcineurin B subunit
Orthology
K17610  
calcineurin B homologous protein 1
Organism
smm  Schistosoma mansoni
Brite
Protein phosphatases and associated proteins [BR:smm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Smp_026420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 188 aa AA seqDB search
MGANTSNTLDQSEVEEIAGETGFSPKQIYRLYNRYLALDKTNAGYLRRHDFLLIPELAIN
PLGDRIVNEFFKDSQGELNFRQFVRKLARFRKVRPQQSTQFNNRDAKLRFLFGMYDLDMD
GKISRNELLGMLQMMVGANITVEQINNIGERTMAEADLDGDCYISYAEFVQAFDNVDIEQ
KMSIRFLE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgaatacttcgaatacacttgatcagtccgaggttgaggaaattgcaggagaa
actgggttttctccaaaacagatttatcgactatacaataggtatttggctttggacaag
acgaacgccgggtatttgaggcgtcatgattttctgttaattccagaattagccattaat
ccacttggcgatcgaatcgtgaatgaattctttaaagatagtcaaggtgaattaaatttt
cgtcaatttgtacgtaaattagcaagatttcgtaaagttcgacctcaacaatcaactcaa
tttaataatcgtgatgcaaaattacgatttctattcggtatgtatgatttagatatggat
ggtaaaatatcaagaaatgaattattgggaatgttacaaatgatggttggtgctaatatt
actgttgaacagatcaataatattggtgaaagaacaatggctgaagcggatcttgatggt
gattgttatatatcttatgcggaatttgtacaagcatttgacaatgtggatattgaacaa
aagatgagtatacgcttcttggaatga

DBGET integrated database retrieval system