KEGG   Schistosoma mansoni: Smp_026420Help
Entry
Smp_026420        CDS       T01095                                 

Definition
(RefSeq) putative calcineurin B subunit
  KO
K17610  calcineurin B homologous protein 1
Organism
smm  Schistosoma mansoni
Brite
Protein phosphatases and associated proteins [BR:smm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Smp_026420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg HTH_23 HTH_28
Motif
Other DBs
NCBI-GeneID: 8354571
NCBI-ProteinID: XP_018655569
GeneDB: Smp_026420
UniProt: G4VT56
Position
W
AA seq 188 aa AA seqDB search
MGANTSNTLDQSEVEEIAGETGFSPKQIYRLYNRYLALDKTNAGYLRRHDFLLIPELAIN
PLGDRIVNEFFKDSQGELNFRQFVRKLARFRKVRPQQSTQFNNRDAKLRFLFGMYDLDMD
GKISRNELLGMLQMMVGANITVEQINNIGERTMAEADLDGDCYISYAEFVQAFDNVDIEQ
KMSIRFLE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgaatacttcgaatacacttgatcagtccgaggttgaggaaattgcaggagaa
actgggttttctccaaaacagatttatcgactatacaataggtatttggctttggacaag
acgaacgccgggtatttgaggcgtcatgattttctgttaattccagaattagccattaat
ccacttggcgatcgaatcgtgaatgaattctttaaagatagtcaaggtgaattaaatttt
cgtcaatttgtacgtaaattagcaagatttcgtaaagttcgacctcaacaatcaactcaa
tttaataatcgtgatgcaaaattacgatttctattcggtatgtatgatttagatatggat
ggtaaaatatcaagaaatgaattattgggaatgttacaaatgatggttggtgctaatatt
actgttgaacagatcaataatattggtgaaagaacaatggctgaagcggatcttgatggt
gattgttatatatcttatgcggaatttgtacaagcatttgacaatgtggatattgaacaa
aagatgagtatacgcttcttggaatga

DBGET integrated database retrieval system