KEGG   Schistosoma mansoni: Smp_026510Help
Entry
Smp_026510        CDS       T01095                                 

Definition
protein kinase
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
smm  Schistosoma mansoni
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Smp_026510
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Smp_026510
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Smp_026510
Protein kinases [BR:smm01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Smp_026510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 544 aa AA seqDB search
MSTSSGSGSRRNRLNLTLPSSAIQSSDNYSTTHKKSEEPVTNAELNKSSDSLQESLQRNG
TSKAASLSDKLDDNNNLTNSSQPVKTSQQTSIYRPSAHHSHPVHRRIPPPLTDLRLSPKK
THTPSNDNLFGSRGDRNNEHRYSNRISTGPVDVAEVYVLSIQDLDDNQRRRLSAFVADKQ
KIGELHPEDFEKLNELGKGNGGVVSRVRHTTTGLIMAKKNIHLEIKPIVKTQIIRELQVL
HDCNSPYIVGYYGAFFADGDISLCMEYMDGGSLDIVLLHAGRLPEPIVAKILYSVIRGLV
YLREVLHIIHRDVKPSNILVNRTGDVKLCDFGVSGQLIDSLANSFVGTRSYMAPERLTGE
QYNTLSDVWSLGLSLVELATGRYPIPAIEDEKVYLSAFSSQRDVNLEQHLEAAKEGKPLP
AVNSPSSGPMAIFELLSYIVDQPPPRLPKFCFSDDFIDLVDSCLRRPASDRPSLENLLKH
RFVVTAAGACPSGNVQRQSTVIDIRQTGGIVDSNQCEDPINIGRYLSSVLPSVTNDDGSN
QNSF
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatcctctgggagtggaagtagacgtaatcggttgaatcttacgcttccgagt
tctgctatccaatcatcagataattattctacaacacataaaaaatccgaggaacctgtc
acaaatgccgagttgaataaatcttcagacagtttacaagaatcattacaaagaaatgga
acttctaaagctgcatcattatcagataaactcgatgataataacaatctaacgaattca
tctcagcctgtgaaaacatctcaacaaactagtatctatcgtccaagtgctcatcattca
catcctgtacaccgtagaatcccaccaccgctcacagatcttcgtttgtctccaaagaaa
acccatacgccgtcaaatgataatctatttggctcgagaggtgatcgaaataatgaacat
cgctattcaaataggatcagcacaggacctgttgatgtcgctgaagtgtatgttttatcg
atacaagatttggatgataatcaacgacgtcgtttaagtgcatttgtagcagataaacaa
aaaattggtgaattacatccagaagattttgaaaagttaaatgaattaggtaaaggtaat
ggtggtgtagttagtcgtgtacgtcatacaacaactggtttaattatggctaagaaaaat
attcatttagaaattaaaccaattgttaaaacacaaattatacgtgaacttcaagtatta
catgattgtaattcaccttatattgttggctattatggtgcattttttgctgatggtgat
attagtttatgcatggaatatatggatggtggaagtttagatattgttctattacatgct
ggtcgtttacctgaaccaattgttgctaaaatattatattctgtaatacgtggtttagtt
tatttacgtgaagtattacatattatacatagagacgtcaaaccatccaatatccttgta
aatcgtacaggtgatgtgaaattatgcgatttcggtgtaagtggtcaactgattgattcc
ttggctaattcatttgttggtacaagaagttacatggcaccggaacgtttaacaggtgaa
cagtacaatacattaagtgatgtatggagtttgggtttatcgttagttgaactggcaact
ggtcgatacccgattccagcaattgaagatgaaaaagtttatctaagtgctttcagttca
caacgagatgtaaacttggagcaacatttagaagcagctaaagaagggaagccacttcct
gctgtcaacagtccaagttccggaccaatggcaatatttgaactattatcctatattgta
gatcaaccaccgcctcgtttaccaaaattttgtttctctgatgattttatcgatttagtt
gattcatgtcttcgacgtccagctagtgatcgaccatctttagaaaatcttttaaaacat
agatttgttgttactgcagctggtgcttgtccatcaggtaatgttcaacgtcaaagtaca
gtaatagatattcgacaaacaggtggaattgttgattcaaatcaatgtgaagatccaatt
aatattggacgttatctttcttctgtattaccatcagtaacaaatgatgatggatctaat
caaaattctttttaa

DBGET integrated database retrieval system