KEGG   Schistosoma mansoni: Smp_026920Help
Entry
Smp_026920        CDS       T01095                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smm  Schistosoma mansoni
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smp_026920
Enzymes [BR:smm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Smp_026920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 303 aa AA seqDB search
MNDNKVKHQSLPTNSLMTMSPTEMNPSYLILKNNDEMNDTTVDHHEHHEQHHQQQLNDDS
NRIGSSTGISLINEPPKRPIKDIQRDYPKTLMTLGGGGGSMLGISDTASIITEGGINDQY
IDLIKAYHNILVAIGENPNRQGLLKTPQRAAKSILYFTKGYEECVNDILNDAIFDEHHDE
LVIVKDIEMFSMCEHHLIPFIGHVSIGYIPNKKILGLSKLARIVEIYSRRLQVQERLTKE
IAIALNESIKPKGVGVIIEATHMCMIMRGVQKINSTTITTTMLGDLKENGKLRDEFLQLA
GRK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaatgataataaagtcaaacatcaatcattacctactaatagtttaatgacaatgtca
ccaactgaaatgaatccatcctatttaatccttaaaaataatgatgaaatgaatgatact
actgttgatcatcatgaacaccacgaacaacaccaccaacaacaacttaatgatgattca
aatcgaataggatcatcaactgggatcagtttaattaatgaacccccaaaacgtccaatt
aaagatatacaaagagattatccaaaaactttaatgacattaggtggtggtggtggtagt
atgttaggtatatcagatactgctagtataattacagaagggggtatcaatgatcaatat
attgatttaatcaaagcctatcataatattttagttgctatcggtgaaaatcctaatcgt
caaggtttattaaaaacaccccaaagagctgccaagtcgatattatattttacaaaaggt
tatgaagaatgtgtcaatgatatattgaatgatgctatattcgatgaacatcatgatgaa
ttagttatagttaaagatattgaaatgttttcaatgtgtgaacatcatctaataccattt
attggtcatgtatctattggttatataccaaataaaaaaattttaggtttaagtaaactg
gcaagaatcgttgagatatattcacgtcgattacaagtacaagaaagacttacaaaagaa
attgctatagcattaaatgagtcaatcaagcctaaaggtgttggtgttatcatagaagca
acacatatgtgtatgattatgcgtggtgtacaaaaaattaattcaactactataacaaca
actatgttaggtgatttaaaggagaatgggaaattacgtgatgaatttctacaacttgct
ggaagaaaataa

DBGET integrated database retrieval system