KEGG   Schistosoma mansoni: Smp_028990.1Help
Entry
Smp_028990.1      CDS       T01095                                 

Definition
protein phosphatase-1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
smm  Schistosoma mansoni
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Smp_028990.1
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Smp_028990.1
Protein phosphatases and associated proteins [BR:smm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Smp_028990.1
Transcription machinery [BR:smm03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Smp_028990.1
Spliceosome [BR:smm03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Smp_028990.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 326 aa AA seqDB search
MAESDKLNIDSLISRLLEVRGSRPGKNVQLSEAEIRGLALKSREIFLRQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIVAIVDEKIFCCHGGLSPDL
HSMEQIRRIMRPTDVPEQGLLCDLLWSDPDKDITGWGENDRGVSYTFGADIVTKFLHSHE
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLTCSFQILKPAD
KKKFNFRSLNSGWPVTPPRNSKLEDK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtcggataagttaaacatcgacagtttgatatcgaggcttttagaagtccgt
gggtctcgtccaggaaagaatgtgcaactatctgaagcagaaataaggggcctagctctg
aagtcaagggaaattttccttcgacagcccattctgctggaactcgaggcaccattaaag
atttgtggcgatattcacgggcagtattatgacctcctccgtttgttcgagtatggaggc
ttcccaccagatgcgaattatttgttcttgggtgactacgttgatcgtggcaaacagtcc
ctcgaaactatttgtcttttactggcctataaaataaaatatcctgaaaactttttcctt
cttcgtggaaatcatgagtgcgcatcaatcaaccgcatatacggcttttacgatgaatgt
aagcggaggtacaacataaagttgtggaagacgttcactgattgtttcaactgcttacca
atagtcgctatagtggatgaaaaaatcttctgctgccatggtggcctctcccctgacctc
cactctatggagcaaatccgtaggattatgcgcccaaccgatgtcccggaacaaggttta
ctgtgtgacctgctttggtccgatccggataaggatattactggatggggggaaaatgac
cgtggtgtgagttatacgtttggtgcagatattgtcaccaagttccttcacagtcacgaa
ttggacctcatctgcagagcacatcaggtcgtggaagatggttacgagtttttcgccaaa
cgccagctcgtaactctattttctgctccaaactattgtggagaattcgataacgctggc
gctatgatgtctgttgacgaaaccctcacttgttcctttcagatattaaaacccgcagat
aagaaaaagttcaacttccggtctctcaattccggatggcctgttactcctccgaggaac
tctaaactcgaagataaatga

DBGET integrated database retrieval system