KEGG   Schistosoma mansoni: Smp_030760Help
Entry
Smp_030760        CDS       T01095                                 

Definition
cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Smp_030760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 594 aa AA seqDB search
MDTFEFYAVVFVIVVLYTSFHKLKRILHKHLQRSHSIGAECKPQRSNHEDLLAVMNRSSI
KVSIFYGSQTGTAKKFAINLGHHLHNCGVRNLVMDLRQTNMEILVNLSMLDNCVALFVVA
TYGEGEPTDSARQFMDNLKNSYQKLDNLRFAVFGLGNSMYTYFNAVGKSIDRLLIQHGGK
RLQTLTLGDEVNELESTFLNWRSHLTSLLIDFFDLNDHDRNYLNKQYKRMYSLKRFNWNV
PLVSHFVNMFINKAHVKETLPYENDNYFYASVAVNQELYHKSSRSCRHIELDVSASQLRY
KTGDHIAIFASNPLDLVEKIGDLLNIDLNEMISLDAVDPDSLTKHPFPCPCTYRHAFMHF
VDITGPPGKSLLSACLDSVTNPEESQFVQLLISDSEDGKKLYSKWILEDHRGLVDVLQDL
KSFRPPADLLLELLNPLKPRLYSISSSSLVHTNRIHITASIVKYKTNSVGKTGQMVLFFG
CRHENKDFIYSDELKQACSTGLLEMFTAFSRDCLDGNKVYVQHKVLEMGNMVWKLLDECY
AYIYVCGDAAGMVRDVHLCLIELVVQRSNLTREAATSYVLNLRKQGRYRTDVWK
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggatacctttgaattttatgctgtcgtttttgtgatcgttgtgttgtatacatctttt
cataaattgaagcggattttacataaacatttacaaaggagtcatagtattggtgctgag
tgcaaaccacaacgttctaatcatgaagaccttctagcagtgatgaatcgaagcagtatc
aaagtgtctatcttttacggatcgcagacagggactgctaaaaaattcgcgattaatctt
ggtcatcatcttcacaactgtggcgtacgtaacttggtgatggatttgagacaaacaaac
atggaaatattagtaaatttgtctatgctggacaactgcgtagcattattcgttgttgca
acttatggtgaaggtgaaccaacagatagtgcccgacaatttatggataatctaaagaat
tcttaccagaagttggataacctacgttttgcggttttcgggttgggcaacagtatgtat
acgtatttcaatgctgttggaaagtcaatcgaccgtttgcttattcaacatgggggtaaa
cgtttacaaacattgactttgggagatgaagtgaatgaattagaatctacgtttttgaat
tggaggagtcacttaacttcgttattgatcgacttttttgatctaaatgaccatgataga
aattacttaaataagcaatataaacgaatgtactctttaaaacgttttaactggaatgtc
ccacttgtttcgcactttgtgaatatgtttataaataaggctcacgttaaggaaacgtta
ccatatgaaaacgacaattatttctatgcttctgtcgctgttaatcaagaattgtatcat
aaaagttcacgttcttgtcgccatattgaactggatgtgtctgcttctcaacttagatat
aaaactggtgatcatattgcaatatttgcatcaaatcctttagatcttgtcgaaaaaatt
ggggatctcctaaacattgatttgaatgaaatgattagtttagatgctgttgatcctgat
agtttaacaaagcatcctttcccctgcccatgtacctatcgtcatgcatttatgcacttt
gttgatattactggacctcctggaaagagtttattatccgcatgtttagattcagtcacg
aatcctgaagaatcacagtttgttcagcttcttatttctgatagtgaagatggaaaaaaa
ttatactccaagtggattttagaagatcatcgtgggctagtcgatgtgttacaagacttg
aaatcatttcgaccaccagctgatcttttgttggagttgttgaaccctctaaaaccaaga
ttgtacagtatatcatcgtcttcattagttcatacaaatcgaatacacataactgcttct
atagtaaaatacaaaacaaactcagttggcaagactggacagatggtgttattttttggt
tgccggcatgaaaataaagattttatttattcagacgaattaaaacaagcctgttctact
ggcctacttgaaatgtttaccgctttctcacgtgactgtcttgatggtaataaagtttat
gttcagcataaggtgcttgagatgggtaacatggtgtggaaacttttggatgaatgttat
gcgtacatttatgtatgtggggatgccgctggtatggtgcgtgacgtccatttgtgttta
atcgaattagtagtacaacgttccaacttaacaagagaagctgcaaccagttatgtactg
aacctacgaaagcaaggacgatatcgtaccgatgtatggaagtaa

DBGET integrated database retrieval system