KEGG   Schistosoma mansoni: Smp_031770.4Help
Entry
Smp_031770.4      CDS       T01095                                 

Definition
tropomyosin
Orthology
K10373  
tropomyosin 1
Organism
smm  Schistosoma mansoni
Brite
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Smp_031770.4
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 284 aa AA seqDB search
MEHIKKKMLAMKLDKENAVDEADQLEAKLREKELEMQTKDEEVAEVLKKIQQVDTDKETA
QTQLAETNTKLEETDKRATEAEAEVASLQKRIRQLEDELESTETRLQEATVKLEEASKAA
DESDRGRKVLENRTFADEERINQLEEQLKESTFMAEDADRKYDEAARKLAITEVELERAE
SRLEAAESKITELEEELRIVGNNVKSLEISEQEAAQREEAYEENIRDLTERLKAAEDRAQ
ESERLVNTLQADADRLEDELVTEKEKYKALSEELDSTFAELTGN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggaacatattaaaaagaaaatgttggcaatgaaattggataaagagaatgctgtagat
gaagctgatcaattggaagcaaaattacgtgaaaaagaattagaaatgcaaactaaagat
gaagaagttgcagaagtacttaaaaaaattcaacaagttgacacggacaaagaaacggca
caaactcaattagctgaaactaatactaaattagaagaaacagataaacgagcaactgag
gccgaagctgaagtcgcctcactacagaagcgaattcgacagcttgaagatgaattggaa
tctactgagactcgtcttcaagaagctactgttaagcttgaagaagcaagtaaagctgct
gatgaaagtgatcgtggtcgtaaagtattggagaatcgtactttcgcagatgaagaacgt
atcaatcagttagaagaacaattaaaagaatctacatttatggctgaagatgctgatcga
aaatacgatgaggcggctcgtaagctggctatcacggaagtggaactcgaacgggctgag
tctcgcctggaagctgccgaaagtaaaattacagaactcgaagaagagttacgcattgtt
ggtaataatgtaaaatctttggagatatctgaacaagaggcagcccagcgtgaagaggca
tatgaagagaatatacgtgatttaactgagcgcttaaaagctgctgaggatcgagctcaa
gaatctgaacgacttgtcaatactttacaagctgatgctgatcgtcttgaagatgaattg
gtcaccgagaaagagaaatataaagcactcagtgaagaattggattcaacttttgcagaa
cttactggaaactaa

DBGET integrated database retrieval system