KEGG   Schistosoma mansoni: Smp_032120Help
Entry
Smp_032120        CDS       T01095                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
smm  Schistosoma mansoni
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Smp_032120
   03008 Ribosome biogenesis in eukaryotes
    Smp_032120
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Smp_032120
Ribosome biogenesis [BR:smm03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Smp_032120
Transfer RNA biogenesis [BR:smm03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Smp_032120
Mitochondrial biogenesis [BR:smm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Smp_032120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 166 aa AA seqDB search
MKISLRDNECPPNGSVWEVTDLLAEDAVIGETPCIYTSSSGSRHIFISTKSGFMSQVLYI
SRHVDRLLYKYHSSSQFDPSKPSEFWIHGIGPLSIMRTAELALHLSHRLYPGHLKISTYT
SSCSTKKHIISQVENEKNSIREESRTKGAIHVHIRLVPTRNAETIP
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcactgagggataatgaatgccctcccaacgggtctgtttgggaggttaca
gacttgctagctgaggatgctgtcatcggcgaaaccccttgtatttacacttcttcatct
ggatctcggcatatcttcatatctacaaagtctggatttatgagccaggtgctttacata
agtcgtcacgtggatcgtttattatataaatatcatagttcatctcaatttgatccctca
aaaccatctgaattttggattcacggtataggaccgcttagtattatgaggacagctgag
ctggctctacatttaagtcatcggctgtaccctgggcacctcaaaatatcaacttacacg
agtagctgttcaactaagaaacatattatatctcaagtagaaaatgaaaaaaattcaata
cgagaagaatcgcggaccaaaggtgctattcatgtccatatccgcttggtccccacacgc
aatgctgagacgattccataa

DBGET integrated database retrieval system