KEGG   Schistosoma mansoni: Smp_033400Help
Entry
Smp_033400        CDS       T01095                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
smm  Schistosoma mansoni
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:smm00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 108 aa AA seqDB search
MGFSEGDIEKGKKLFVQRCSQCHTVEKGGPHKVGPNLSGLFGRKTGQAPGYTYTAANISK
GIIWNEQSLFEYLENPKKFIPGTKMVFAGLKKDTDRNDIISYLKEATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggggttctccgaaggtgatattgagaaaggaaagaagctattcgttcagagatgtagt
cagtgtcataccgtcgagaagggtggtcctcacaaagtgggacccaacttaagtggtctg
tttggtcgtaaaactggtcaagctcctgggtatacctacactgctgccaacataagtaaa
ggtatcatatggaatgagcagtctctatttgagtatttggaaaatccgaaaaagtttatc
cctggtacaaagatggtctttgctggtttaaagaaagacactgatcgcaatgatatcatt
tcctaccttaaagaagcaacaaaataa

DBGET integrated database retrieval system