KEGG   Schistosoma mansoni: Smp_035580Help
Entry
Smp_035580        CDS       T01095                                 

Definition
protein phosphatase-1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
smm  Schistosoma mansoni
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:smm03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 322 aa AA seqDB search
MTSEVDVDELISRLLEVRSSRPGTTVNMKEEEVRYLCVTSRQIFLSQPILLELQAPLKIC
GDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKHPENFFLLR
GNHECAAINRIYGFYDECKRRFSVRLWKTFTDCFNCLPIAAIVDSKIFCCHGGLSPDLQN
MDQIRRIMRPSDIPDTGLLCDILWSDPDKDVNGWAENDRGVSFTFGPDVVTKFLNRHDMD
LICRAHQVVEDGFEFFCRRQLVTLFSAPNYCGEFDNAGGMMSVDENLTCSFQILKPSEKK
AKYQYQGVNTTGNQARLPARIP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagaagtagacgtagatgagcttattagtaggctcctggaggtccgatcatcc
agacccgggactactgtaaatatgaaggaagaagaagtacgatatctctgtgttacttca
cgacaaattttcttatcacaacctattttgttggaattacaagctcctttgaaaatttgc
ggtgatattcacggccaatacacagacttgttacgtcttttcgaatacggtggttttcct
ccagaatctaactacctgtttcttggagactatgtggacagaggcaagcagagtttagaa
actatttgccttctacttgcgtataaaattaaacatccagaaaactttttccttcttcgt
gggaatcatgaatgtgctgctattaatcggatatatggattttatgatgaatgtaaacga
cgttttagtgttcgattatggaaaacgttcactgattgcttcaactgtttaccaatcgct
gcaattgtagattcaaaaatattttgttgtcatggtggattatctccagatttacaaaat
atggatcaaatacgacgtatcatgagaccgtcagatattcctgatacaggacttttatgc
gatattttatggtcagatccggataaagatgttaatggttgggctgaaaatgatcgtggt
gtgagcttcacattcggtccagatgtagttactaaatttctcaaccgacatgatatggat
ttaatttgtcgagcgcaccaagtagttgaagatggtttcgaatttttctgtcgtcgtcaa
ttagtaactttattttctgctccaaattattgcggtgaatttgataatgccggtggtatg
atgtctgtagatgagaatttaacatgttcatttcagatacttaaaccatctgaaaagaag
gctaaatatcaatatcaaggtgtaaacactactggaaatcaagctagattgcctgctcgt
ataccatga

DBGET integrated database retrieval system