KEGG   Schistosoma mansoni: Smp_044250Help
Entry
Smp_044250        CDS       T01095                                 

Definition
subfamily M67C unassigned peptidase (M67 family)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
smm  Schistosoma mansoni
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:smm04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 366 aa AA seqDB search
MNRTPQERLDALLKSAEDFTIIQNIDISHYARFIRSMFRLSVQFSEAGQKERAYILSIRA
VLCIRELPNHNGYHRLDPRVQNELKSLGKLLPKSAEFLKDDLKKKYTEEYELYKKSLSIT
EWKVNTNGPVVPFLNHTSKPYDDYPVDPNSYRHSLSNLSSVNGTLYPAFNKALNYTPDEL
PRSLYSNYTGNYGLTKTYLSRHLISDFLSLASKNTKGNRETCGTLCGKLISGNFYITNLL
IPKQSGTPDSCVTYNEEEIFEYLDRRQLITLGWIHTHPTQTAFLSAVDLHCQLSYQTMLP
EAIAIVCAPKFDDIKCFSLTPDHGISFLSKCKKTGFHPHATDLPLYEQSQHVIFDDTIEH
SSDDLR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaactccccaagaacgtctggatgctctccttaagtctgccgaagatttcact
atcattcaaaatatagacatttctcactatgcacggtttatccggtcgatgtttcgtttg
tctgtccagttctcagaagcaggtcaaaaagaaagagcgtacatattatccataagagct
gttttgtgtatccgagaattacctaatcataatggttaccatagactggatccacgtgtt
caaaacgaactcaaaagtcttggtaaattactcccaaaatctgccgagttcttaaaggat
gatttgaaaaagaagtacacagaggaatatgagttgtataaaaagtcacttagtataact
gaatggaaagtgaatacaaatgggccagtggtaccctttcttaatcatacttcaaaacca
tatgatgactatccagttgatcccaactcttatagacactccttgtctaatttatcttca
gttaacgggacattatatcccgcttttaataaagccctcaactatactcccgatgaactc
ccaagatctttgtacagtaactacacaggaaattatggtttaacgaaaacatatttatct
cgacatctgattagtgactttttgagcctagctagtaaaaacactaaaggaaatcgagaa
acttgtgggaccctatgtgggaaattaattagtggcaatttctatattacaaaccttcta
attccgaaacaaagtggtactccagactcttgcgttacgtataatgaagaggaaatattc
gagtacttagacaggaggcagctgatcacattgggttggattcatacacatcctactcaa
acggctttcttatcggctgttgatctacattgtcaactgtcttaccagactatgcttccg
gaagcgattgcaattgtatgcgctcctaagttcgatgatattaaatgtttttcattaact
cctgatcacggcatttcattcctgtcaaaatgtaaaaaaacaggtttccatccacatgcc
acagatctcccattatatgaacaaagtcaacatgtaatatttgacgacactattgaacat
tcttctgatgatctccgataa

DBGET integrated database retrieval system