KEGG   Schistosoma mansoni: Smp_044850Help
Entry
Smp_044850        CDS       T01095                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smm  Schistosoma mansoni
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smp_044850
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Smp_044850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 365 aa AA seqDB search
MKKSHVTVVGSLNVDLSVFTNIIPKVGETVTGSNFLLGYGGKGANQCVASRVLGCNTALV
GKVGDDYFGEMFIQHLKQLGVSTDGISRSSMNSTGVASITVETGTGGNQIIIVPGANMLV
SEKDISFAEKLTLLDTKVIVCQFEINPSATLYSLRLGRAKGAKTILNPAPAPVASGNPEI
LGNYELMEDILPNCDFVCPNESEFCSITESDSGSLFSKNEIGSLNIDAFIPGLAYLLEKK
IKCPIVTLGSKGVIAILSEQDMANIYAKDASEVARITFENQEKLVVHFSAPSNFDVVDTT
GAGDCFVGSLAYFVACHEDITLAEQIRRSVWVASQSIRKKGTQSSYLKRDELPDTLFASE
TFQWP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcgcacgtcacagttgttggctcactcaacgttgacctatccgtattcaca
aatatcattccaaaggtaggagagacagtaactggttcgaattttcttcttggttacggg
ggtaaaggagcaaatcagtgtgtggcttccagagtactgggatgcaacactgcactggta
ggaaaagttggcgatgactattttggtgagatgtttattcagcacttgaaacaacttggg
gtgagcactgacggtatatcaagatcatcaatgaatagtactggagttgcatcaattaca
gttgaaacaggaacaggtggaaatcaaattatcatcgtcccaggtgcaaatatgcttgta
tcagaaaaagacatttcctttgcagagaaactaaccctcttggatacaaaagtaatagtt
tgccagtttgaaatcaatccatctgcaacactttatagtttgaggcttggtcgtgccaaa
ggtgcaaagacaattttaaatcccgcacctgcgccagtggcttctggaaatcctgagatt
ttggggaattacgaattaatggaagatattttaccaaattgtgattttgtgtgtccaaat
gagtccgaattttgttccataaccgagtctgactctggatcacttttttccaaaaatgag
attggctcactgaatatagatgcttttattcctggtcttgcctacttacttgaaaagaaa
atcaaatgccccatagtaactctagggagtaaaggagttattgcaattttatctgaacaa
gatatggcaaatatatatgccaaagacgctagcgaagtggctcgtattacttttgaaaac
caagagaagttggtagtacacttctcagcacccagtaactttgatgttgttgacacaaca
ggagcaggagactgttttgttggctcactagcttactttgtcgcgtgtcacgaggacatt
actctggctgaacaaataagacgatcggtttgggttgccagccaatcaatccgtaaaaaa
gggacacaatctagttacctgaaacgtgatgaacttcctgatacactctttgcatcagaa
acatttcagtggccatag

DBGET integrated database retrieval system