KEGG   Schistosoma mansoni: Smp_045810.1Help
Entry
Smp_045810.1      CDS       T01095                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
smm  Schistosoma mansoni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Smp_045810.1
Enzymes [BR:smm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Smp_045810.1
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smp_045810.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 332 aa AA seqDB search
MNSTHPLHSSYSNLLFRQWQTANYKVSAENLVYPIFLRYIILFSHSFSQDPDCDKIITSL
IDQRRIGCNRIIEFLTPLVAKQLKSVLLFGTISKDQKDATGSACDTPNSPVIQAIKLLKS
KFPDLIVICDVCLCAYTDSGHCGILRDDGCLDVPRTLERLAEISKRFALEGADVIAPSDM
MDGRVKKIKMAIESIGLSGKVAVMSYSAKFASCLYGPFRDAAQSAPSFGDRRHYQLPPGA
KGLALRAAIRDANEGADFIMVKPGLPYLDIVNELRQLLPHHPLAVYHVSGEYAMLKHAAN
AGAIDLKQAALELMTAFRRAGKFAYQTMFAYA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaattctactcatcccctccattcatcatactcaaatttgttgttcagacagtggcaa
actgcaaactataaggtcagtgccgagaatcttgtgtatccaattttcctcaggtatatt
atattgttttctcattcatttagccaagacccagattgtgataaaataattactagccta
atagaccaacgtcgaataggatgcaaccgaatcatcgagttcttaacacctttggtggcc
aagcaactaaaatctgtattgttgtttgggacaatcagtaaagaccaaaaagatgctaca
ggatcagcttgtgatacaccaaattcaccagtcattcaggcaatcaagttgctgaagtca
aaatttccggatttaatagtgatttgtgatgtttgtttgtgtgcatacactgacagtggt
cattgtggtattttacgtgatgacggctgccttgacgtacctagaactcttgaacgttta
gcggaaatatctaaacgatttgccctagaaggagctgatgttattgccccttctgacatg
atggatggacgtgtgaaaaaaatcaagatggctatagagagtatcggtctcagtgggaaa
gtagccgttatgtcttattcagccaaatttgcatcttgtttgtacggtcctttcagagat
gctgctcaatctgcaccttcttttggagaccgtcggcattaccagcttcctcctggtgcc
aaaggattggctctacgtgctgctattcgcgatgcgaacgaaggagctgacttcataatg
gtaaaacctggtcttccttatctggatattgtgaatgagctacgacagttgctacctcat
catcctctagcagtttatcatgtttctggtgaatatgcaatgctaaaacatgccgcaaat
gctggggctatcgatttaaagcaagccgccttagaattgatgactgcattccgtcgtgcc
ggtaaatttgcataccagacaatgtttgcttatgcttaa

DBGET integrated database retrieval system