KEGG   Schistosoma mansoni: Smp_045810.2Help
Entry
Smp_045810.2      CDS       T01095                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
smm  Schistosoma mansoni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:smm00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 322 aa AA seqDB search
MNSTHPLHSSYSNLLFRQWQTANYKVSAENLVYPIFLSQDPDCDKIITSLIDQRRIGCNR
IIEFLTPLVAKQLKSVLLFGTISKDQKDATGSACDTPNSPVIQAIKLLKSKFPDLIVICD
VCLCAYTDSGHCGILRDDGCLDVPRTLERLAEISKRFALEGADVIAPSDMMDGRVKKIKM
AIESIGLSGKVAVMSYSAKFASCLYGPFRDAAQSAPSFGDRRHYQLPPGAKGLALRAAIR
DANEGADFIMVKPGLPYLDIVNELRQLLPHHPLAVYHVSGEYAMLKHAANAGAIDLKQAA
LELMTAFRRAGKFAYQTMFAYA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaattctactcatcccctccattcatcatactcaaatttgttgttcagacagtggcaa
actgcaaactataaggtcagtgccgagaatcttgtgtatccaattttcctcagccaagac
ccagattgtgataaaataattactagcctaatagaccaacgtcgaataggatgcaaccga
atcatcgagttcttaacacctttggtggccaagcaactaaaatctgtattgttgtttggg
acaatcagtaaagaccaaaaagatgctacaggatcagcttgtgatacaccaaattcacca
gtcattcaggcaatcaagttgctgaagtcaaaatttccggatttaatagtgatttgtgat
gtttgtttgtgtgcatacactgacagtggtcattgtggtattttacgtgatgacggctgc
cttgacgtacctagaactcttgaacgtttagcggaaatatctaaacgatttgccctagaa
ggagctgatgttattgccccttctgacatgatggatggacgtgtgaaaaaaatcaagatg
gctatagagagtatcggtctcagtgggaaagtagccgttatgtcttattcagccaaattt
gcatcttgtttgtacggtcctttcagagatgctgctcaatctgcaccttcttttggagac
cgtcggcattaccagcttcctcctggtgccaaaggattggctctacgtgctgctattcgc
gatgcgaacgaaggagctgacttcataatggtaaaacctggtcttccttatctggatatt
gtgaatgagctacgacagttgctacctcatcatcctctagcagtttatcatgtttctggt
gaatatgcaatgctaaaacatgccgcaaatgctggggctatcgatttaaagcaagccgcc
ttagaattgatgactgcattccgtcgtgccggtaaatttgcataccagacaatgtttgct
tatgcttaa

DBGET integrated database retrieval system