KEGG   Schistosoma mansoni: Smp_053140Help
Entry
Smp_053140        CDS       T01095                                 

Definition
tip60
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Smp_053140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 463 aa AA seqDB search
MVVSNSKKNIEGCKLPVKLPDSDFFHNAEILGTRDVGDCTYYYVHYDDYNKRLDEWVSAD
RLDFSRIERPLKKSTKEPVTPVFSLSSTEDEVISSAELRTSESDLNPPLKYRSSSSSSLT
QLKRKRPPDDIYEGPIHLTLQNDLNDLVFDDSPTSAGKPRQTGSMVSSHHEQDTVTRMRN
LEWIELGRYRIKPWYFSPYPQELASVPCVYICEFCLKYLKSFTCLRRHLAKCTLRNPPGN
EVYRKLPHSFFEIDGRKNKTYAQHLCLLAKLFLDHKTLYYDTDPFLFYVLCEVDSRGYHL
VGYFSKEKESSEDYNVACILVLPPFQRKGYGKYLIEFSYELSKIEGKSGSPEKPLSDLGL
LSYRSYWAQTILELLLNSKATETGQDPALSINDIVDRTCIKRDDVIATLSHLNVLYYVKG
QHVIYLSRDLIQAHQKSMQRRNLRVDAKLLNWKSRDWSKRGRW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtttctaactcaaaaaagaatattgagggttgcaaactaccggtaaaactaccg
gattctgactttttccataatgccgagattttgggtacccgtgatgtaggtgattgtaca
tactactacgttcactatgatgactataacaaacggctggatgaatgggtcagtgctgat
cgcctcgacttttctagaatagaacgaccattgaagaaatctacgaaagaacctgttact
cctgttttcagcttatcctccactgaggatgaagttattagttcagcggagctccgaact
tcagaatcggacctgaaccctcctctaaaatatcgtagctccagctcctctagtttgacc
caactcaaaagaaaacgaccccctgacgatatctatgaaggacctatacatttgacgctg
cagaacgacttgaatgatcttgtgtttgatgactctccaacttctgctggaaaacccagg
caaacaggtagtatggtttctagccaccatgaacaagatactgttacaagaatgagaaat
ctggaatggattgaattaggaagatatcgaattaaaccatggtacttttccccatatcca
caggaattagcaagcgttccgtgtgtatatatatgcgaattctgtttgaagtatttgaag
agtttcacttgtctgcgcagacacctggctaaatgtacactaagaaatcctcctgggaac
gaggtttaccgcaaactgcctcacagttttttcgagatcgatgggcgtaaaaataaaact
tacgcacaacacctttgtcttcttgcgaaactgttcttggatcacaaaactttatattac
gacacagatccatttttgttttatgttctttgtgaagtagactctcgtggttaccatctg
gttggatatttctcaaaagaaaaagaatcctctgaagactacaacgtggcatgcatctta
gtacttccaccttttcaacgaaaaggttatggaaagtatttgattgaatttagctatgaa
ctgagcaaaattgaaggtaaatctggatctcctgaaaaaccgttaagtgatttgggccta
ttatcttatcgttcttattgggctcaaacaattcttgaattgttactaaactcgaaagca
acagaaactggtcaggatcctgcactaagtataaatgatattgttgatagaacatgtatt
aaacgtgatgatgtcattgctacattatctcatttaaatgtattatattatgtaaaagga
caacatgttatctatttatcacgtgatctaatacaagcacatcaaaaatctatgcaacgt
cgtaatctaagagttgatgcaaaattattaaattggaaatcaagagattggagtaaacgt
ggtcgatggtga

DBGET integrated database retrieval system