KEGG   Schistosoma mansoni: Smp_053230Help
Entry
Smp_053230        CDS       T01095                                 

Definition
NADH-cytochrome B5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
smm  Schistosoma mansoni
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smp_053230
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Smp_053230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 304 aa AA seqDB search
MTQNTTAVIAIVASVSAVVAISGVVLGLIFRPKKPKKTLVDNDTKVPLRVVDRSFITHDT
IRLKLGLPTADHVLGLPVGNHVYFSAKLDGNMVVRPYTPITLDSQKGYVDFVIKVYKGNV
NPKFPKGGVMSQYLANLPVDGFIDVRGPSGRLEYKGSGLFHIKPDLRSSPNPVKVKHVNM
ICGGSGITPMFQLLSYILQSKDDTTQIAMVFANVTEKDIILRDELENFKDKYPNHFRLWY
TVNEAPERWAYSTGYVNEQILQEHIYPAKDDTITLICGPPPFIEFACLPSLSKLDYPKNM
IHVF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaatacgacagctgttattgctattgtagcttcagtatcggcagttgttgct
atttcgggtgtcgtattgggactaatattcaggcctaaaaagccgaaaaaaactcttgtg
gataatgatacgaaagttcctttacgagtagtggatagaagtttcatcactcatgataca
atccgcctaaaactaggacttcccacagctgaccatgttcttggattgcctgttggtaat
catgtatatttcagtgcaaaacttgatggaaatatggtcgttcggccttacaccccgatc
acactagacagtcaaaaaggatatgttgacttcgtcataaaagtgtataaaggaaacgtt
aatcccaaatttcctaaaggtggagttatgtcgcaatatttggctaatctccctgtcgat
ggatttattgatgttcgtggtccatctggaagattggaatacaaagggtctggtttattc
catataaagccggatctacgtagttcacctaaccctgtaaaagtaaaacatgtcaatatg
atttgtggtgggtctggtataacaccaatgttccaactattatcctacatacttcagtct
aaagatgatacaacgcaaatagcaatggtttttgctaatgtgactgaaaaagatataatt
ctacgtgatgaactagaaaatttcaaagataaatatccaaatcattttcgtctttggtat
acagtaaatgaagcacctgaacgttgggcatacagtactggttatgtgaatgaacaaata
ttacaagaacatatttatccagcaaaagatgatacaatcacattaatttgtggtccgcca
ccatttattgaatttgcttgtcttccatcactttctaaattagattatccaaaaaatatg
attcatgtcttttga

DBGET integrated database retrieval system