KEGG   Schistosoma mansoni: Smp_053900Help
Entry
Smp_053900        CDS       T01095                                 

Definition
beta-hexosaminidase B
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
smm  Schistosoma mansoni
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smp_053900
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Smp_053900
   00603 Glycosphingolipid biosynthesis - globo series
    Smp_053900
   00604 Glycosphingolipid biosynthesis - ganglio series
    Smp_053900
   00511 Other glycan degradation
    Smp_053900
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Smp_053900
Enzymes [BR:smm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Smp_053900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 524 aa AA seqDB search
MNSSITCLLYLLFILVYYVSKCYSIVPKAYKHHKTGIYYNFAESLTYNHSYTSCYILTDA
LKRFEERLTLIKQYPKIPTSLPNNTINIIKISITNGCDESSDELWPSESMNETYSLIIFN
QRIILKSKEIWGILHGLETILQLIYRDPLERNIIEGGIILDGPLFPHRGFLIDTSRHYLS
LKEIEKFLDSMSMVKMNVLHWHIVDDQSFPYVSETFPKLSSKGAFHPYILIYTPNDMKYI
LNYARLRGIRIMPEFDTPGHTNSWGKGYPEVLTKCYINGELDGTLGPINPINNFSYNFVS
QLYKELFNVFPDNWFHLGGDEVEYHCWRSNPLIIEFMKQMKFGDDYHRLEGYYIKNLIQI
ISDVKPTGRNITPVVWQEIFQNGFRGDKSAVIHVWKDSDWKSVMKNVTKTGYRVLFSAAW
YLNYISYGDDWRNYYHVDPRDFGGSKEDAKLVVGGEAAIWGEYVDDTNLFSRSWPRGSAV
AERLWTEGSPNTTDFVPRVEELRCRMLSRGWNAEPINGPGFCPL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttccataacttgtcttctgtacttattgttcattctagtttactatgtttct
aaatgttattcaatagtcccgaaagcctataaacaccataagacaggaatttattataat
tttgctgaatctctaacgtataatcattcatacacaagttgttatattttaacagatgca
ttaaaacgttttgaagaacgtctcacattaataaaacagtatcctaaaatccctacttct
ttgccaaataatacaatcaatatcatcaaaatatcaataactaatggatgtgacgagtca
agtgacgaattatggccttctgaatcaatgaatgagacatattcccttattattttcaat
cagagaataatcttaaaatcaaaagaaatctgggggattttacatggattggaaactata
cttcaattaatttacagagatccattagagagaaacataattgaaggtggtataattttg
gatggaccattatttccccatagaggatttttaattgatacatctagacattatttatca
ttaaaggagatcgaaaaatttcttgattcaatgtcaatggtgaaaatgaatgtacttcac
tggcatattgtggacgatcaatcttttccctatgtatctgaaacgtttccgaaactttcc
tcaaagggagcatttcacccgtatattttaatctatacaccgaacgatatgaaatatata
ctaaattatgctcgtttacgaggaataagaataatgccggaattcgatacaccaggtcat
acgaattcttgggggaaaggatatccagaggttttaaccaaatgttatattaatggtgaa
ctggatggtactctgggtccaatcaatccaatcaataatttctcctataactttgtgtca
caattatacaaagagttgttcaatgtatttcctgataactggtttcatttaggtggggat
gaagttgaatatcattgttggcgttccaatcctttgattattgaattcatgaaacaaatg
aagtttggtgatgattatcaccgtctggaaggctattacataaaaaatctaattcaaatt
attagtgatgttaaaccgactggacgaaatattactccagttgtttggcaggaaatattt
caaaatgggtttagaggtgataaatcagcagtaattcatgtgtggaaagactcagattgg
aaatctgtgatgaaaaatgttaccaaaacaggctatagagtactattctcagctgcttgg
tacctgaattacatttcttatggtgatgactggcgtaactactatcacgttgatccgaga
gatttcggaggtagcaaggaagatgcgaaattggttgttggaggtgaagcagctatctgg
ggtgaatatgtggatgacacgaatttgtttagtcgatcatggcctcgaggttcagctgta
gctgagagattatggactgaaggttcaccaaacacaacggattttgtcccaagggtggaa
gaacttcgttgtcgaatgctgagccgcggttggaacgctgaaccaataaatggaccagga
ttttgtccgctttaa

DBGET integrated database retrieval system