KEGG   Schistosoma mansoni: Smp_053900Help
Entry
Smp_053900        CDS       T01095                                 

Definition
beta-hexosaminidase B
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
smm  Schistosoma mansoni
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smm00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:smm00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:smm00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:smm00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:smm00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:smm04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 524 aa AA seqDB search
MNSSITCLLYLLFILVYYVSKCYSIVPKAYKHHKTGIYYNFAESLTYNHSYTSCYILTDA
LKRFEERLTLIKQYPKIPTSLPNNTINIIKISITNGCDESSDELWPSESMNETYSLIIFN
QRIILKSKEIWGILHGLETILQLIYRDPLERNIIEGGIILDGPLFPHRGFLIDTSRHYLS
LKEIEKFLDSMSMVKMNVLHWHIVDDQSFPYVSETFPKLSSKGAFHPYILIYTPNDMKYI
LNYARLRGIRIMPEFDTPGHTNSWGKGYPEVLTKCYINGELDGTLGPINPINNFSYNFVS
QLYKELFNVFPDNWFHLGGDEVEYHCWRSNPLIIEFMKQMKFGDDYHRLEGYYIKNLIQI
ISDVKPTGRNITPVVWQEIFQNGFRGDKSAVIHVWKDSDWKSVMKNVTKTGYRVLFSAAW
YLNYISYGDDWRNYYHVDPRDFGGSKEDAKLVVGGEAAIWGEYVDDTNLFSRSWPRGSAV
AERLWTEGSPNTTDFVPRVEELRCRMLSRGWNAEPINGPGFCPL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttccataacttgtcttctgtacttattgttcattctagtttactatgtttct
aaatgttattcaatagtcccgaaagcctataaacaccataagacaggaatttattataat
tttgctgaatctctaacgtataatcattcatacacaagttgttatattttaacagatgca
ttaaaacgttttgaagaacgtctcacattaataaaacagtatcctaaaatccctacttct
ttgccaaataatacaatcaatatcatcaaaatatcaataactaatggatgtgacgagtca
agtgacgaattatggccttctgaatcaatgaatgagacatattcccttattattttcaat
cagagaataatcttaaaatcaaaagaaatctgggggattttacatggattggaaactata
cttcaattaatttacagagatccattagagagaaacataattgaaggtggtataattttg
gatggaccattatttccccatagaggatttttaattgatacatctagacattatttatca
ttaaaggagatcgaaaaatttcttgattcaatgtcaatggtgaaaatgaatgtacttcac
tggcatattgtggacgatcaatcttttccctatgtatctgaaacgtttccgaaactttcc
tcaaagggagcatttcacccgtatattttaatctatacaccgaacgatatgaaatatata
ctaaattatgctcgtttacgaggaataagaataatgccggaattcgatacaccaggtcat
acgaattcttgggggaaaggatatccagaggttttaaccaaatgttatattaatggtgaa
ctggatggtactctgggtccaatcaatccaatcaataatttctcctataactttgtgtca
caattatacaaagagttgttcaatgtatttcctgataactggtttcatttaggtggggat
gaagttgaatatcattgttggcgttccaatcctttgattattgaattcatgaaacaaatg
aagtttggtgatgattatcaccgtctggaaggctattacataaaaaatctaattcaaatt
attagtgatgttaaaccgactggacgaaatattactccagttgtttggcaggaaatattt
caaaatgggtttagaggtgataaatcagcagtaattcatgtgtggaaagactcagattgg
aaatctgtgatgaaaaatgttaccaaaacaggctatagagtactattctcagctgcttgg
tacctgaattacatttcttatggtgatgactggcgtaactactatcacgttgatccgaga
gatttcggaggtagcaaggaagatgcgaaattggttgttggaggtgaagcagctatctgg
ggtgaatatgtggatgacacgaatttgtttagtcgatcatggcctcgaggttcagctgta
gctgagagattatggactgaaggttcaccaaacacaacggattttgtcccaagggtggaa
gaacttcgttgtcgaatgctgagccgcggttggaacgctgaaccaataaatggaccagga
ttttgtccgctttaa

DBGET integrated database retrieval system