KEGG   Schistosoma mansoni: Smp_056760Help
Entry
Smp_056760        CDS       T01095                                 

Definition
protein disulfide-isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
smm  Schistosoma mansoni
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:smm04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 482 aa AA seqDB search
MKLSVALVVVFLVFAASEVTEEDDVLVLNKKNFDDVIKTNKFVLVEFYAPWCGHCKALAP
EYSEAAKKLKEKGSLIKLAKVDATVEEELAFKHGVKGYPTLKFFRNEQPIDFGGERDSDA
IVNWCLRKSKPSVEYIDSLDSCKQFIDKANIAILGFIKDTDSLDLADFEKVADELDDADF
AIANSSEILTEYGITQTPKIVLFKNFDENRVEYTGGTLENLKHFIQVESVPLVSEFSQKT
AGVVFGSPIQKHIVFFLSKSTDHSDLVDKLTEVARQFKGKLHVIYVDVDVENNLRVLEFF
GLSKNDAPTYRIIELGEETTKYKPDTNDYSVSAMSDFVQRTIDGKVKPFLMSEEIPSDQT
GAVKVLVGKNYNDVVKDKSKDVFVKLYAPWCGHCKALAPVWDELGETFKNSDTVIAKMDA
TVNEVEDLKVTSFPTLKFYPKNSEEVIDYTGDRSFEALKKFVESGGKSSEATKQEDQIKD
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtccgtcgctcttgttgttgttttccttgttttcgctgcgtcagaggtcact
gaggaagatgatgtacttgtattaaataaaaagaactttgatgacgttatcaagaccaat
aagtttgttttggttgagttctatgctccttggtgtggtcactgtaaggctcttgcccca
gaatacagtgaagcagccaaaaaattaaaggaaaaaggttcgctaatcaaacttgctaaa
gtggatgctaccgtcgaagaagaacttgctttcaaacatggtgtcaagggatatccgact
ttaaagttcttccgaaacgaacaacctatcgattttgggggtgaaagagactccgatgca
atcgtaaactggtgcttaagaaaatccaaaccttccgtggaatatattgattcattagat
agttgtaaacaatttatcgacaaggctaacattgccatattgggatttatcaaggatacg
gactcgttagatttggcagatttcgaaaaagtggccgacgagttagatgatgctgatttt
gcaatagctaattccagtgagattttgactgagtatggtatcacgcagactccaaaaatt
gttctgtttaaaaatttcgacgaaaatcgtgttgaatatacaggaggaacgcttgaaaat
ctaaagcatttcatacaggtggaaagtgtccctcttgtgtcagaattctcccagaaaacc
gctggagttgttttcggaagtccaattcagaaacacatcgtcttcttcctctcaaaatca
acagaccactcggatctcgttgataaactgacagaagttgcaagacaattcaaaggcaag
cttcatgtgatatacgtcgacgttgatgtcgaaaacaacttacgtgtgttggaatttttc
gggctttcgaaaaatgatgccccgacttaccgtattatcgaacttggtgaagaaacaact
aaatataaaccagatactaacgattactctgtttccgcaatgtctgatttcgttcaaaga
acaatcgatgggaaagtcaaacctttccttatgagtgaagaaataccatcagaccaaaca
ggtgctgttaaggttcttgttgggaaaaattataacgatgtggttaaagacaaatcaaaa
gacgtgtttgtcaaactgtatgctccttggtgtggtcattgcaaggctcttgctccagtt
tgggatgaattgggtgagactttcaagaactcagatacggtgatcgcaaaaatggatgct
acggttaatgaagttgaagatcttaaagttaccagttttccaactctaaagttttatcca
aagaactcggaggaggttattgattatacaggtgatagatcatttgaagccctgaaaaag
ttcgtcgaatctggtggtaaatccagtgaagcaactaaacaagaagatcaaataaaggat
gaactttaa

DBGET integrated database retrieval system