KEGG   Schistosoma mansoni: Smp_058140.1Help
Entry
Smp_058140.1      CDS       T01095                                 

Definition
protein-l-isoaspartate o-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smm  Schistosoma mansoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 234 aa AA seqDB search
MAWKSSGSTHAELINNLFRNRVISSEIVRNTMLSVDRGYFAKSNSYEDRPSSIGYAATIS
APHMHAYALEALKDHLKPGAHVLDVGSGSGYLTACMALMVGPTGVAVGIEHIDELTKFSL
SNVENWFNHSQNARLSGIELGKQLKLVTGDGREGWPSDAPYDAIHVGAAAPVIPNALKEQ
LKIGGRLICPEGPEGGNQALVQIDRLQDGSFQRKSLMGVIYVPLTDKDRQVGPR
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcttggaagtcgagcggtagcacacatgcagaacttataaacaatctattcagaaat
cgagtaatatcatctgaaattgtcaggaatactatgctttccgtggatcgtggatatttt
gctaagtcgaattcttacgaagaccgaccatcgtctattggctatgccgcgactatcagt
gctcctcatatgcatgcttatgctctggaagcattaaaagatcatcttaaacctggtgca
catgttttagatgttggatcgggtagtggatatttaacggcgtgtatggctcttatggta
ggccctacaggtgttgctgtaggcatagaacatattgatgagttgactaaattttctctg
tcaaatgttgaaaattggtttaatcatagccaaaatgctcgactatctggaattgaatta
ggaaaacaacttaaacttgttactggtgatggtcgtgaaggatggccgtcagatgcacct
tatgatgcaattcacgtaggtgcagcggctccagttattcctaatgcactaaaagaacaa
ttgaaaattggtggtcgtttaatttgtcctgaaggaccagaaggtggaaatcaagcgtta
gttcaaattgatcgtttgcaagatggttcctttcaaagaaaatctttaatgggtgtgatt
tatgttccgttaaccgataaagatcgacaagttgggccaaggtaa

DBGET integrated database retrieval system