KEGG   Schistosoma mansoni: Smp_058140.4Help
Entry
Smp_058140.4      CDS       T01095                                 

Definition
protein-l-isoaspartate o-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Smp_058140.4
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 202 aa AA seqDB search
MAWKSSGSTHAELINNLFRNRVISSEIVRNTMLSVDRGYFAKSNSYEDRPSSIGYAATIS
APHMVGPTGVAVGIEHIDELTKFSLSNVENWFNHSQNARLSGIELGKQLKLVTGDGREGW
PSDAPYDAIHVGAAAPVIPNALKEQLKIGGRLICPEGPEGGNQALVQIDRLQDGSFQRKS
LMGVIYVPLTDKDRQVGPRKWH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttggaagtcgagcggtagcacacatgcagaacttataaacaatctattcagaaat
cgagtaatatcatctgaaattgtcaggaatactatgctttccgtggatcgtggatatttt
gctaagtcgaattcttacgaagaccgaccatcgtctattggctatgccgcgactatcagt
gctcctcatatggtaggccctacaggtgttgctgtaggcatagaacatattgatgagttg
actaaattttctctgtcaaatgttgaaaattggtttaatcatagccaaaatgctcgacta
tctggaattgaattaggaaaacaacttaaacttgttactggtgatggtcgtgaaggatgg
ccgtcagatgcaccttatgatgcaattcacgtaggtgcagcggctccagttattcctaat
gcactaaaagaacaattgaaaattggtggtcgtttaatttgtcctgaaggaccagaaggt
ggaaatcaagcgttagttcaaattgatcgtttgcaagatggttcctttcaaagaaaatct
ttaatgggtgtgatttatgttccgttaaccgataaagatcgacaagttgggccaaggaag
tggcattaa

DBGET integrated database retrieval system