KEGG   Schistosoma mansoni: Smp_058460Help
Entry
Smp_058460        CDS       T01095                                 

Definition
eukaryotic translation initiation factor 3 (eif3)-related
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
smm  Schistosoma mansoni
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Smp_058460
Translation factors [BR:smm03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Smp_058460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 671 aa AA seqDB search
MPSFAGLDVDDEEIIPDILEQKPKVEDHLGSTVIVDGCPVVGPAKFELLKKFLLDKFSKI
GPIVDHEFPLDNEKQTKGYIFITYENGKAASQAVRTMNNVPLDKNHTFQVTLLSDFERVT
NVPTEWVPPPKQEYKDLGNLKSWLLNEFCRDQFAVVYNDGETGSVYWHTAVEPVVAEERA
HWTDGWMRWSPRGTYLATMHSLGVILWGGEKFQRIGRFPHSCVKTIEFSPLEQFMITLSP
SPNFPTDERADAIVWDVKRCVSRREFSVPIDFHPAFKWSPKDEYFACLRDGVISIYCASN
FRLLDKKKLGGNIRDFSWSPSDNILAYWVPESDNTPARVVLMEVPSRQELCTKNLFSVAE
ISLLWHEQGDFLAVQVLRCAKKKLDGEKQVKYVGTYTNFEIVRLREKLYPVDQLEVKGTV
SNFQWEPCGTRFAFLQSVTSGKLSIAIYDVSRGTNVREVTVLDLASPRTNDLRWSSKGGI
IVAAGLRSADGILEFISANDGQILAKGEHPTVSDIQWDPTGRYIATTVSSFYQKNDNAIW
FWNCVGRCLYKMNLRGIRTFTWRPRPPTLLSAEQLQAIKKNMSKYNSQLANEDRMLASKA
SRELLEKRQKLLTEFNIWKNAIIKLYNKDEEERFRLRGSGADTSTREPQTEEELEILISA
VHETIRKNTDD
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgtttgcaggcttggacgttgacgatgaggaaattattcctgatattctggaa
cagaaacccaaagttgaagaccacttgggttcaacagttatagtggatggatgtcctgtt
gttggcccagccaaattcgagctgcttaaaaagtttttgctagataaattttcgaaaatc
ggcccgatagtggatcatgaattccctctggataatgaaaaacaaacaaaagggtatatt
ttcattacctatgaaaacggaaaggcagcatcacaagctgttcgaaccatgaataatgtt
cctctggacaagaatcacactttccaggttactttattgtcagatttcgaacgtgtaaca
aatgttccaactgaatgggtacctccaccgaaacaagaatataaggatttaggtaatttg
aagagctggttgttgaatgagttttgtcgggaccagtttgctgttgtctacaatgatggt
gaaactggatctgtttactggcatactgctgtcgaaccagtcgtggctgaagaacgtgct
cattggactgatgggtggatgcgatggtcacccagagggacttatttggcaacaatgcat
tctttgggtgttattttatggggcggtgagaagttccaaagaatcggtcgttttccccat
tcatgtgtcaaaacaatcgagttttcacctttggaacaatttatgataaccttgagtcca
agccccaactttcccaccgatgaacgtgcagacgcaatcgtgtgggatgtgaagcgctgt
gttagtcgtcgagagttctccgttccaatcgattttcatccggccttcaagtggtcgcca
aaggatgaatattttgcatgcttgcgagacggtgtcattagtatttactgtgctagcaat
tttagacttttggataaaaagaaacttgggggcaatattcgcgatttttcttggtcacct
tctgataatattctagcctactgggtgcctgaatctgataatactccagccagagttgtt
cttatggaagtaccaagtcgccaggaactatgcacaaagaatttattttccgtagctgaa
atcagtcttctatggcatgaacaaggtgactttttagctgttcaagtattaaggtgtgca
aaaaagaagttggacggtgaaaagcaagtgaaatatgtgggtacctacaccaattttgaa
atagttcgtttaagagaaaaattatatcctgttgatcagctggaagttaaaggcactgtt
tcgaattttcaatgggaaccttgtggcacacgtttcgctttcttacaatctgtaacaagt
ggaaaattgtcaatcgccatttatgatgtatctcgtggaactaatgttcgtgaagttact
gttcttgatcttgcctcacctcgaaccaatgatcttcgttggtcatctaagggtggcatt
attgtagcagcaggtttaagaagtgctgatgggatactggaattcatttcagcaaatgat
ggtcagattttagctaagggagaacatccaactgttagtgatatacaatgggatcctaca
gggaggtatatagcgacaacagtaagtagtttctatcagaagaatgataatgcaatatgg
ttttggaattgtgtgggtcgttgcttgtataaaatgaacttgcgtggtattcgtactttc
acctggagaccacgaccacctacactactcagcgccgaacagcttcaggctattaaaaag
aatatgtcaaaatataattcacagttagccaacgaagatcgtatgcttgcttcaaaggct
agcagagaattacttgagaaacgacaaaaactattaactgaattcaatatttggaaaaat
gctatcattaaattatataataaagatgaagaagaacgctttagattaagaggttctggc
gctgatacatcaactcgtgagcctcaaacagaagaagaattggaaattttaatcagtgct
gtccatgaaacaattcgtaaaaatacagatgattaa

DBGET integrated database retrieval system