KEGG   Schistosoma mansoni: Smp_059980Help
Entry
Smp_059980        CDS       T01095                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
smm  Schistosoma mansoni
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:smm00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 364 aa AA seqDB search
MLKSVATPYYPIQDEKPKLLYTSANFLGIPTNRGQPKIGTYQGPELIRKSNFFQLVAEDG
IQLTDCGDIIPVELNEAEDPQRFGMKWSRSFSLTTLRIAERVEELMKQSNKHTVELSGSK
STPLVIVGGDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLNSASGNMHGMPLSFLVK
ELQDQIPWLDDFEGIKPCLNASNIAYIGLRDLDAHETHDIRKHGIAYFTMLDVDRMGIEA
VIKEALLAVNPRLEKAIHLSFDIDALDPLVAPSTGTAVPGGLTLREGLRICEEVSATGKL
SVVELAELNPLLGSQEDVLKTQSSAVHILRACLGHCRSGHLPFKVRNLTDQGIMSRAAHM
QTKQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaatcagtcgcgaccccttactatcctattcaagatgagaaaccaaagctttta
tatacatctgcaaatttcttgggtatacccactaacaggggacaaccaaaaattggtaca
tatcaaggaccagaacttattcgaaaatctaattttttccagcttgtagctgaagacgga
atacagttaactgactgtggagatatcatacctgtagagctaaatgaagcagaggatcca
caacgtttcgggatgaaatggtcacggagtttctcattgaccactttaagaatagccgaa
cgtgtggaggaattaatgaaacagtcgaataaacatactgtcgaattaagtggatcaaaa
tcaactccattagtaattgttggtggtgatcatagtatggcgactggaacaatacttggg
catgctgaagctaaaccagatctctgtgtgttatggattgatgctcatggtgacataaat
acaccgctaaactcagcttctggaaatatgcacggaatgcctttaagttttctggtaaaa
gaattacaagaccaaataccgtggttggacgactttgaaggcataaaaccttgtctcaac
gccagtaatattgcctatattggtttgcgggatttagacgctcatgaaacacatgatatt
agaaaacatggcatcgcttattttacaatgctggatgttgatcgaatggggatagaggct
gttattaaagaagcattgctagcagtaaatccaagattagaaaaagctattcacttaagt
tttgatatagatgcactggatccgttagtagctccgagtactggtactgctgttccaggt
ggtttaacattacgtgaaggtttgagaatatgtgaagaagtttcagcgacaggaaaactt
tctgtagttgagttggctgaattaaatcctttattaggatctcaggaagatgttttaaaa
actcagtcatctgctgttcatattttaagagcatgtttaggccattgtcgttcgggtcat
ttaccattcaaagttcgtaatttaactgaccaaggtattatgagtcgggcggcacatatg
cagacaaaacaataa

DBGET integrated database retrieval system