KEGG   Schistosoma mansoni: Smp_060170Help
Entry
Smp_060170        CDS       T01095                                 

Definition
(RefSeq) mRNA export protein rae1-related
  KO
K14298  
mRNA export factor
Organism
smm  Schistosoma mansoni
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Smp_060170
Messenger RNA biogenesis [BR:smm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Smp_060170
Chromosome [BR:smm03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Smp_060170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
Position
W
AA seq 365 aa AA seqDB search
MTLFTSGTQNVFNSVNIGANKTMSAAQKTAEVQSPPGDTVSCLRFSPESMQTTFLAATSW
DNRIRIWEVQANGSTIPKAEQMHQGPVFGACWSTDGSKLFSVSADKTAQMWDLGSNTFTQ
VGVHDAPVKTAHFITAPNYSCLMTGSWDKRLRFWDTRQSQPILNLDLPERIYCADVHYPL
ALVGTAGRQIFVYNLENGPTQFSQLESPLKFQSRCISIFMDKQKQNPSGFALGSIEGRVA
IQYLNPTTPKDNFTFKCHRSNAPVNGYHEIFAVNDMAFHPVHGTLATVGSDGCYSFWDKD
ARTKLHSSDSPDQPLTCCVFDPKGQVFCYASGYDWSKGYQFADPSKPIKIMMRLCMEDMT
PGRKS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacactctttactagtgggacacaaaatgtctttaattcagttaatatcggcgcaaat
aaaaccatgagtgctgcacaaaaaacggccgaagttcagtctcctccaggggatacagta
tcgtgtcttcgcttcagtcctgagtctatgcaaacgaccttcttggctgctactagttgg
gataatcgtattagaatttgggaagtacaagccaatggttctaccattccaaaagctgaa
cagatgcatcaagggcctgtttttggggcttgctggagcaccgatggttcaaaacttttc
agtgtatcagcagacaaaactgcgcaaatgtgggatcttggttcaaacactttcacgcaa
gttggtgtgcatgatgctcccgtcaaaactgcccattttattactgctccaaattattct
tgtttgatgacaggttcatgggataaaagacttagattctgggatacaagacaatctcag
cctattttaaacttggatttgccggaaaggatctattgtgctgacgttcattatccactt
gctcttgtcgggactgcaggtcggcaaatatttgtgtataatttagaaaacggtcctact
cagttcagccaattagagtctcctcttaaatttcagagtcgttgtatatctatattcatg
gacaaacaaaaacaaaatcccagtggatttgccctaggaagcattgaagggcgtgtcgcc
atacagtatttaaatccaactacgcctaaagataatttcacttttaaatgtcatcgttct
aatgcaccggtcaacggttaccatgaaatttttgcagtaaatgatatggctttccatcca
gtgcatggcacactagccacagtgggatctgatggatgttattcgttttgggataaagat
gctagaactaaattacattcttcggattctccagatcaaccactcacttgctgtgtattt
gatcctaaaggccaagtgttctgttatgcgtcaggttatgattggtctaaaggatatcag
ttcgccgatccatctaaacccatcaaaataatgatgcgcttgtgtatggaagatatgact
cctggtagaaaatcataa

DBGET integrated database retrieval system