KEGG   Schistosoma mansoni: Smp_060170Help
Entry
Smp_060170        CDS       T01095                                 

Definition
mRNA export protein rae1-related
Orthology
K14298  
mRNA export factor
Organism
smm  Schistosoma mansoni
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Smp_060170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 339 aa AA seqDB search
MTLFTSGTQNVFNSVNIGANKTMSAAQKTAEVQSPPGDTVSCLRFSPESMQTTFLAATSW
DNRIRIWEVQANGSTIPKAEQMHQGPVFGACWSTDGSKLFSVSADKTAQMWDLGSNTFTQ
VGVHDAPVKTAHFITAPNYSCLMTGSWDKRLRFWDTRQSQPILNLDLPERIYCADVHYPL
ALSGLQSRCISIFMDKQKQNPSGFALGSIEGRVAIQYLNPTTPKDNFTFKCHRSNAPVNG
YHEIFAVNDMAFHPVHGTLATVGSDGCYSFWDKDARTKLHSSDSPDQPLTCCVFDPKGQV
FCYASGYDWSKGYQFADPSKPIKIMMRLCMEDMTPGRKS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacactctttactagtgggacacaaaatgtctttaattcagttaatatcggcgcaaat
aaaaccatgagtgctgcacaaaaaacggccgaagttcagtctcctccaggggatacagta
tcgtgtcttcgcttcagtcctgagtctatgcaaacgaccttcttggctgctactagttgg
gataatcgtattagaatttgggaagtacaagccaatggttctaccattccaaaagctgaa
cagatgcatcaagggcctgtttttggggcttgctggagcaccgatggttcaaaacttttc
agtgtatcagcagacaaaactgcgcaaatgtgggatcttggttcaaacactttcacgcaa
gttggtgtgcatgatgctcccgtcaaaactgcccattttattactgctccaaattattct
tgtttgatgacaggttcatgggataaaagacttagattctgggatacaagacaatctcag
cctattttaaacttggatttgccggaaaggatctattgtgctgacgttcattatccactt
gctttgtcgggactgcagagtcgttgtatatctatattcatggacaaacaaaaacaaaat
cccagtggatttgccctaggaagcattgaagggcgtgtcgccatacagtatttaaatcca
actacgcctaaagataatttcacttttaaatgtcatcgttctaatgcaccggtcaacggt
taccatgaaatttttgcagtaaatgatatggctttccatccagtgcatggcacactagcc
acagtgggatctgatggatgttattcgttttgggataaagatgctagaactaaattacat
tcttcggattctccagatcaaccactcacttgctgtgtatttgatcctaaaggccaagtg
ttctgttatgcgtcaggttatgattggtctaaaggatatcagttcgccgatccatctaaa
cccatcaaaataatgatgcgcttgtgtatggaagatatgactcctggtagaaaatcataa

DBGET integrated database retrieval system