KEGG   Schistosoma mansoni: Smp_060290Help
Entry
Smp_060290        CDS       T01095                                 

Definition
family C86 unassigned peptidase (C86 family)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Smp_060290
Peptidases [BR:smm01002]
 Cysteine Peptidases
  Family C86
   Smp_060290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 193 aa AA seqDB search
MNSVNDSNKIYHERQSKMFCALHALNNVFQDKIFSKHCLDKIADNLNSSSFINPHRNVFG
LGNYDANVLVIALQQCGYDIVWCDKRKTIAAHNLNFDNIFGYILNTFSNRRIFNLTLPYS
GSHWIGLRKLEHDDKYSYFNLDSKLCKPVVVASTDDEFVNYLEGRLREYPETQLLFVVSN
EVLRQRSWTHNKQ
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagtgaacgattcaaataaaatttaccatgaacgtcaatctaaaatgttttgt
gcattgcatgcactgaataatgtatttcaagataaaatattttcaaaacattgcttagat
aaaatagctgataatcttaatagcagttcatttattaatccacatagaaatgtatttgga
ctggggaattatgatgcaaatgtgctagttattgctcttcaacaatgtggatatgatatt
gtttggtgcgataaacgcaaaacaatagctgcgcataatctaaattttgataatattttt
ggatatatactgaacacattttctaatcgtcgtatttttaatttaacattgccatattca
ggaagtcattggattggtttacgaaaattagagcatgatgataaatattcatattttaat
ttagattctaaattatgcaaaccggttgtagttgcatcaacggatgatgaatttgttaat
tatttagaaggacgtcttagagagtatccagagactcaacttttatttgtcgtatccaat
gaagtgcttcgacaacgatcttggacgcataataaacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system