KEGG   Schistosoma mansoni: Smp_062530Help
Entry
Smp_062530        CDS       T01095                                 

Definition
suppressor of variegation 4-20-related
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
smm  Schistosoma mansoni
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Smp_062530
Enzymes [BR:smm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Smp_062530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 613 aa AA seqDB search
MRIRGSKLPPDMNVAKKNPIPNVTGSHQMTWKELAEADDLASALTVDPYLGFTTHKMTDM
KLRIPERIKRKFRDIICNFQKHKCYDAAYNQLIADPNIVKRPWSVDPRFKEHVTRYLLLF
DDRSGIEIRPCWRYASENHMGASIFATRDWAKGSRISTLVGCIAELKHHEEAAFLKHHKN
DFSVMYSSRKNCSQLWLGPAAYVNHDCHPNCEFTINCDVDARMSLEAKMDIKCGDEIFIY
YGTHFFDTNNRACECFTCELLGRGYFSKFTQAIDSTTVSDQKLISNIVNGQENYTRNIAS
YQNDRYNPNVHSHVLLDKMNLLPDNTPSAYNEAENAKQLPLGFFLEKGSSTGLACKALPN
AYALRHTGSRLNRVKARLFAAKVASVNKSFGVNSHENRKPKVKPSYKKCSLRMTVSNIIP
SLRRNKSSSNPHAIGRKRRMKSVAAVKNRQILSDAQVKDNFTSRKIISNLSDHNIVCDGI
SWQESDGTSSGLGQSVNNDSSGYNSPLPPDLDRMSSTSPNNSFSETIVVTPDLESSYYLE
SAVQACTDNRNMKRKPSDISVPFSIPIISPLRITDLCVSKYGKLNECGTESRFSLTQMIN
LRHRLTLENVYFN
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaggatacggggatctaaattaccacctgatatgaatgttgcaaagaagaaccctatt
cctaatgtcacagggagccatcagatgacttggaaggagttggctgaggctgatgatctt
gcttccgctctcaccgttgacccttatcttgggttcactacccataaaatgactgatatg
aagttaaggattccagagagaattaaaagaaagtttcgtgatattatatgcaactttcag
aaacataaatgttatgatgctgcctataatcagttgatagccgatccaaatattgtaaaa
cgtccttggagtgttgatcctcggttcaaagaacatgtcactcgttatcttttattgttc
gatgatcgttctggcatcgaaattcgaccgtgttggcgctatgcatcggaaaaccatatg
ggtgcttcaatttttgcaacaagagattgggccaaaggatcacgtatcagtaccttggtg
ggatgtattgctgaacttaaacatcacgaagaagctgcatttctgaagcatcacaaaaat
gacttttcggtcatgtattcttctaggaaaaattgctctcagttgtggttgggtccagct
gcttacgttaatcatgattgtcatccaaactgtgagttcacaattaactgtgatgttgac
gctcgtatgagtctagaagctaaaatggatataaaatgtggtgatgaaatttttatctat
tatggtactcactttttcgatacaaataatagagcttgtgagtgttttacttgcgagtta
ttggggcgcggttattttagtaaattcactcaagcaattgatagtaccactgtttccgat
caaaaactgatttcaaatattgtgaatggtcaagaaaactataccagaaatatagcatca
tatcaaaatgaccgttacaatcctaatgttcacagtcatgttcttctggacaagatgaat
ttattaccagacaatactccgtctgcatataatgaggcagaaaatgctaagcaattacct
ttgggttttttcctagaaaagggatcttccactggtttagcttgtaaagcattacctaat
gcctacgccttacgccatactggatctcgtctaaaccgtgtgaaagctcgactatttgct
gcaaaagtagcttctgtaaacaagtcctttggtgtgaacagtcacgaaaacagaaagcca
aaagtcaagccttcttacaaaaagtgctcattaagaatgacagtttcgaatattattccc
tctttgagaagaaacaagtcaagttcaaatccccatgccattggtagaaaaagacgaatg
aaatctgtcgctgccgtaaaaaatcgacaaatattgtctgacgctcaagtaaaggacaat
tttacttcgagaaaaattatcagtaacctatctgatcacaatatagtttgtgatggtata
tcatggcaagaatcagatgggacaagtagtggattaggacagagtgttaacaatgacagt
agtggctacaatagtccattgccaccagatttggatcgcatgtcatcaacttcaccaaac
aattcatttagtgagacgattgttgttacacctgatcttgaatcatcttactatcttgaa
tcagcagttcaagcgtgcactgacaatcggaatatgaaacgaaaaccatctgatattagt
gttccgttttctataccaatcatcagtccattacgaattacagatttgtgtgtttcgaag
tatggcaaattgaacgaatgtggtactgaatcacgtttttcattgacacagatgattaat
cttagacaccgtttaacgttagaaaatgtttatttcaattaa

DBGET integrated database retrieval system