KEGG   Schistosoma mansoni: Smp_064950Help
Entry
Smp_064950        CDS       T01095                                 

Definition
(RefSeq) putative calcineurin B
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
smm  Schistosoma mansoni
Pathway
smm04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Smp_064950
Protein phosphatases and associated proteins [BR:smm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Smp_064950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 8342863
NCBI-ProteinID: XP_018655028
GeneDB: Smp_064950
UniProt: G4VPT6
Position
W
AA seq 169 aa AA seqDB search
MGNEASLPDLCSTFDVEEIKRLAKRFKKLDLDGSGSLSVKEFMSLPELQQNPLVARVIEI
FDTDGNGEVDFKEFIDGMSQFSVKGEKEAKLKFAFKIYDMDKDGYISNGELFQVLKMMVG
NNLKDTQLQQIVDKTIMFADKDGDGRISFEEFCEVVSGLDVHKKMVVDV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgaagcttctcttccagatctttgctctacatttgacgttgaagaaataaaa
cgtttggctaaacggtttaaaaaactagatcttgatggttctggatctttaagtgtaaaa
gagttcatgagtcttcctgaacttcaacaaaaccctttagttgcaagagttatcgagatt
tttgatacggatggcaacggagaagttgacttcaaggaattcatagatggaatgtcacag
ttcagtgtaaagggtgagaaagaagccaagttgaaatttgcgtttaaaatatacgacatg
gacaaagatgggtacatcagtaatggcgaattatttcaggttttgaaaatgatggttgga
aacaacttaaaagatactcaactacaacaaatagtggataaaactatcatgtttgctgac
aaagacggagatggtcggatttcgtttgaggagttttgtgaagttgttagcggtcttgat
gtgcataaaaaaatggtagttgatgtttga

DBGET integrated database retrieval system