KEGG   Schistosoma mansoni: Smp_064950Help
Entry
Smp_064950        CDS       T01095                                 

Definition
calcineurin B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
smm  Schistosoma mansoni
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Smp_064950
Protein phosphatases and associated proteins [BR:smm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Smp_064950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 169 aa AA seqDB search
MGNEASLPDLCSTFDVEEIKRLAKRFKKLDLDGSGSLSVKEFMSLPELQQNPLVARVIEI
FDTDGNGEVDFKEFIDGMSQFSVKGEKEAKLKFAFKIYDMDKDGYISNGELFQVLKMMVG
NNLKDTQLQQIVDKTIMFADKDGDGRISFEEFCEVVSGLDVHKKMVVDV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgaagcttctcttccagatctttgctctacatttgacgttgaagaaataaaa
cgtttggctaaacggtttaaaaaactagatcttgatggttctggatctttaagtgtaaaa
gagttcatgagtcttcctgaacttcaacaaaaccctttagttgcaagagttatcgagatt
tttgatacggatggcaacggagaagttgacttcaaggaattcatagatggaatgtcacag
ttcagtgtaaagggtgagaaagaagccaagttgaaatttgcgtttaaaatatacgacatg
gacaaagatgggtacatcagtaatggcgaattatttcaggttttgaaaatgatggttgga
aacaacttaaaagatactcaactacaacaaatagtggataaaactatcatgtttgctgac
aaagacggagatggtcggatttcgtttgaggagttttgtgaagttgttagcggtcttgat
gtgcataaaaaaatggtagttgatgtttga

DBGET integrated database retrieval system