KEGG   Schistosoma mansoni: Smp_066410Help
Entry
Smp_066410        CDS       T01095                                 

Definition
(RefSeq) Pyruvate dehydrogenase protein X component,mitochondrial precursor (Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex) (Lipoyl-containing pyruvate dehydrogenase complex component X) (E3-binding protein) (E3BP) (proX),putative
  KO
K13997  
dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex
Organism
smm  Schistosoma mansoni
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smp_066410
   00020 Citrate cycle (TCA cycle)
    Smp_066410
   00620 Pyruvate metabolism
    Smp_066410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
Position
Unknown
AA seq 483 aa AA seqDB search
MSARLCLLRLQCLRHFVHTSRKIQFPVHIKMPSLSPTMSEGSIVNWVKNEGEDVAAGDVL
CEVQTDKAVIAFESDEEGVLAKILAPTGSSNIKVGSLIAVLATPDEHWQEVAASAASLSQ
PSTADSIPKQSGINRTIQEPQSYRLCSMGPAVRLLLQSHDIDGSQIISTGPHGQLLKGDV
LAYIANNEIKPVVSSQEKSINDIPAIQTVSSAANFTDITSSNMRNSFAQRLSESKLSIPH
EYIRATARIDRLNELITELKVNSDINFSINDFIVKACALGLRLVPDLNAIYDSQAESPIY
LRSVDLSMAVTTRSGLLTPILHSADSLIVSDISKLSQQLVQKARDGLLQPHELDGGSFTI
FNLGIYDIREFTTIVNHPQVAILAVGTDLPEACISTSCTENEITFSTDITLTLSMDSRCV
SEVAACSFLKYVCSLLGDYPHLLLDSDPVSLLLKRNNTSSQRDDEFDNLILSKVNTDIIQ
TLV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccgcttatgtctcttaagattacaatgtttgcgacatttcgtccatacttca
agaaaaatacaattccctgttcatatcaaaatgccatctttgtccccaaccatgtctgag
ggctcaatcgtcaactgggttaagaatgaaggagaggatgtagctgctggagatgtcctc
tgtgaagttcagacggacaaagcggttattgcatttgagtcagacgaggaaggtgtactt
gccaaaatattggcacccaccggctcatcaaatatcaaagtcggtagtttgattgctgtg
ttagccactccagacgagcattggcaagaggtggctgcttctgccgcatcactatcccag
ccatctacagcggacagtattccaaagcagtcaggaataaatcgcaccattcaagaacca
cagtcataccgtctttgttccatgggacctgcggttcgtcttctgttacagtcacacgat
atcgatggatctcaaataatttctacagggccacatggtcaattgcttaaaggggatgtt
ttagcatacatagctaacaacgaaattaaacctgttgtatctagtcaagaaaaatcaatt
aatgatatccccgctatacaaactgtctcgtcagcagccaatttcacagatatcacgtca
tcgaatatgaggaattctttcgcccaacgtttgtcagaatcaaaattgtctatcccacat
gaatatattcgcgcaactgctcgcatagatcgtttaaatgaattgataacagaactgaaa
gtgaattcggatataaatttttctataaacgatttcattgtcaaagcttgtgctttaggc
ttaaggcttgttccagatttaaacgccatttatgattctcaagccgagtctcccatttat
ctgagatcagtcgatttaagtatggcagtaacaactagatcagggttacttacgccaatt
ttgcattctgcagactcacttatcgtttctgatatttcgaagttgtcacaacagttagtg
cagaaagcacgagatggtctattacaaccacatgaacttgacggtgggagtttcacaatc
tttaatcttggaatctacgatattcgagagttcaccactattgtgaatcatcctcaagta
gctattttagctgttgggactgatttgccagaggcttgtatctcaacatcatgtacagaa
aatgaaataactttttcaaccgatataacgctaacattgtcaatggactcacgatgtgta
agtgaagttgctgcatgttctttcttgaagtacgtttgtagtttgttaggagactatccg
catcttttgctcgatagtgatcctgtttctttgttattgaagcgtaataatacatcctct
caacgagatgatgaatttgataacttaatcctttcgaaagtgaatacggatattattcaa
accttagtttga

DBGET integrated database retrieval system