KEGG   Schistosoma mansoni: Smp_068170.1Help
Entry
Smp_068170.1      CDS       T01095                                 

Definition
pyruvate dehydrogenase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
smm  Schistosoma mansoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 386 aa AA seqDB search
MRLSQTIFILSGKFADHFIRFGGYTPTPLSLKKLIAFGKVGSVQKSASFLAYELPVRLAN
ILQEIHLLPERLVRTPSASLVRRWYEQSFCELMDFEKIEWDEKSLNQFNEILASIRSRHT
TVVETMAQGVMEMQGNYKTDIVTNNQVQYFLDRFYMMRISIRMLLSQHLLMFGSELNKHR
RYVGSIDPDCNVREILDDAHEDAKFLCEHYYSAAPEMEVRVHSVKVTKTTEDVSQVWNRA
AYHVVKYYVSLPKHISDLGGGIPRSQMDLVFNYTYTTARQAERCGEPSLSSMELGPPDQG
TNAPMAGYGYGLPLSRLYAKYFNGDLILSSVEGYGTDAIVYLKRNAAEADELLPVFNRTS
AKQYGSASIPVADWSNPHITTGWRRN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgattatcccagactatttttattctaagtggaaaatttgctgaccactttatacga
tttggtgggtacactcccactcccttatcgctgaaaaagctgattgcatttggtaaagtc
ggctctgttcagaagtctgcatcattcttggcttatgaacttcctgttcgcctggcaaat
attttgcaagaaattcatttactccctgaacgactcgtcagaaccccttctgcatctctt
gtgagacgatggtacgagcaaagcttctgcgaattgatggacttcgaaaaaatagaatgg
gacgaaaaaagtttaaatcagttcaatgaaatcctcgccagtattcgtagtcgtcacacg
actgtcgttgaaacgatggcacagggtgtaatggaaatgcagggaaactacaagactgat
atagttaccaacaaccaggtgcagtacttcttggacaggttttatatgatgagaatcagt
attcgtatgctgcttagccagcacttgcttatgtttggttcagagttgaataaacataga
agatacgtaggctcgattgatcctgattgcaatgttcgagaaatattggatgatgcacac
gaggatgccaagtttctttgtgagcattactattcggcggctcctgaaatggaggtccgg
gtgcatagtgtcaaagtcacaaaaactactgaagatgttagtcaagtttggaatcgtgct
gcctatcatgtggtcaagtactatgtatctttgccaaagcatatttctgatttgggtggt
ggtatcccacgatctcaaatggatttagttttcaattacacttatacaactgcccggcag
gctgaacgatgcggtgaaccatctttatcgtccatggaactcggacctcctgatcaagga
accaatgctccaatggcaggttatggttatggtcttccacttagtcgattatatgcaaag
tatttcaatggtgatcttatactatccagcgtagaaggctacggaactgatgctatagta
tatttaaaacgtaatgctgctgaggctgacgaactacttcctgtgttcaatcgtacatct
gctaaacaatatggaagtgctagtatcccggtcgctgactggtctaatcctcatataaca
actggttggcgacgaaattaa

DBGET integrated database retrieval system