KEGG   Schistosoma mansoni: Smp_068170.1Help
Entry
Smp_068170.1      CDS       T01095                                 

Definition
(RefSeq) putative pyruvate dehydrogenase
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Smp_068170.1
Protein kinases [BR:smm01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   Smp_068170.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c NodS DUF3361
Motif
Other DBs
NCBI-GeneID: 8354624
NCBI-ProteinID: XP_018648259
GeneDB: Smp_068170.1
UniProt: G4V9Y0
Position
1
AA seq 386 aa AA seqDB search
MRLSQTIFILSGKFADHFIRFGGYTPTPLSLKKLIAFGKVGSVQKSASFLAYELPVRLAN
ILQEIHLLPERLVRTPSASLVRRWYEQSFCELMDFEKIEWDEKSLNQFNEILASIRSRHT
TVVETMAQGVMEMQGNYKTDIVTNNQVQYFLDRFYMMRISIRMLLSQHLLMFGSELNKHR
RYVGSIDPDCNVREILDDAHEDAKFLCEHYYSAAPEMEVRVHSVKVTKTTEDVSQVWNRA
AYHVVKYYVSLPKHISDLGGGIPRSQMDLVFNYTYTTARQAERCGEPSLSSMELGPPDQG
TNAPMAGYGYGLPLSRLYAKYFNGDLILSSVEGYGTDAIVYLKRNAAEADELLPVFNRTS
AKQYGSASIPVADWSNPHITTGWRRN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgattatcccagactatttttattctaagtggaaaatttgctgaccactttatacga
tttggtgggtacactcccactcccttatcgctgaaaaagctgattgcatttggtaaagtc
ggctctgttcagaagtctgcatcattcttggcttatgaacttcctgttcgcctggcaaat
attttgcaagaaattcatttactccctgaacgactcgtcagaaccccttctgcatctctt
gtgagacgatggtacgagcaaagcttctgcgaattgatggacttcgaaaaaatagaatgg
gacgaaaaaagtttaaatcagttcaatgaaatcctcgccagtattcgtagtcgtcacacg
actgtcgttgaaacgatggcacagggtgtaatggaaatgcagggaaactacaagactgat
atagttaccaacaaccaggtgcagtacttcttggacaggttttatatgatgagaatcagt
attcgtatgctgcttagccagcacttgcttatgtttggttcagagttgaataaacataga
agatacgtaggctcgattgatcctgattgcaatgttcgagaaatattggatgatgcacac
gaggatgccaagtttctttgtgagcattactattcggcggctcctgaaatggaggtccgg
gtgcatagtgtcaaagtcacaaaaactactgaagatgttagtcaagtttggaatcgtgct
gcctatcatgtggtcaagtactatgtatctttgccaaagcatatttctgatttgggtggt
ggtatcccacgatctcaaatggatttagttttcaattacacttatacaactgcccggcag
gctgaacgatgcggtgaaccatctttatcgtccatggaactcggacctcctgatcaagga
accaatgctccaatggcaggttatggttatggtcttccacttagtcgattatatgcaaag
tatttcaatggtgatcttatactatccagcgtagaaggctacggaactgatgctatagta
tatttaaaacgtaatgctgctgaggctgacgaactacttcctgtgttcaatcgtacatct
gctaaacaatatggaagtgctagtatcccggtcgctgactggtctaatcctcatataaca
actggttggcgacgaaattaa

DBGET integrated database retrieval system