KEGG   Schistosoma mansoni: Smp_068250Help
Entry
Smp_068250        CDS       T01095                                 

Definition
Protoporphyrinogen oxidase chloroplast/mitochondrial precursor
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
smm  Schistosoma mansoni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Smp_068250
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Smp_068250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 510 aa AA seqDB search
MRIPHYLIVGGGLSGLVTSYLISLTRPLGSYRLTVLESSSRWGGWIQSVKNMDTGSIYEI
GPHSARAKSATSGLLMRIVKSLHLESSLVWMRQGTDGAKQLMYINDQLLPMSAFNFSTLK
PFTRSTCSLIIRRLFSRRPPSQSDWTVDEFLRSRFDSEFADYFGSALMRGIFAADSRNLS
ARACLPTMVKWEEYGPNLILGILLSRINRSLDRIVIPNMIDDKLPQLNNLIPSDAIAWTL
SGGLETLIDTIVDHLSRKHPHIDLQLNCSVEKLKSVNGCFEYTYKSIGDNGNDKEKNTAD
IVFFCCPSFTTASILENILTTDILSYLKPDCIPWGSVVSAVLEIDDSFTPLVRGFGHLVP
RTEDEHILGVIYDSFAFPKLDGFNKKLRYTVMMKPLREWLEASTSLGSSEHLENTIEKVA
KTVLINHLKIPDPVIVGRHISILRNCIPQYPPGHLTNMANLRNGIRRISSGHSSGRSGIY
LVGNSYDGVGLNDAVYSAACAVAEEFSSSS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattcctcattacttaattgtcggtggtggtttatccggtttagttacttcttac
ctcatctcattaactcgaccattgggaagttaccgtttaacagttttggagagtagcagt
aggtggggtggttggattcagtcggttaaaaatatggatactggatcaatctatgaaatc
ggtccacatagcgctcgtgcaaaatctgccacatcaggtcttttgatgagaatagtaaaa
agtttgcatcttgaaagctcacttgtttggatgaggcagggtacagatggagcgaagcaa
ttaatgtatataaatgaccaactgttgccaatgtctgccttcaatttctccactttaaaa
ccattcactaggtccacttgtagtttaatcatcaggcggttattttctcgacgcccaccg
tctcagtcagactggactgttgatgaattccttcgctctcgttttgattccgaatttgct
gactactttggcagtgctctgatgaggggtatctttgctgctgattcacgaaaccttagt
gctcgtgcttgtttgcctacgatggtgaagtgggaagaatatggaccgaatcttattctc
gggattttactttcacggataaaccgatctttagatcgtatcgttataccaaatatgatt
gacgacaaactcccgcaactgaataacttgattccatctgatgcgattgcttggactttg
tcaggtggattggagacattgattgacactattgtagatcatttaagtaggaaacatcca
catatcgatttgcagttaaactgttccgttgaaaaattaaaatctgtaaatggttgcttt
gagtatacttacaagagcatcggtgataatggtaacgacaaagaaaaaaatacagctgat
atagtctttttttgctgcccatccttcactacagcaagtattttggaaaacatactgact
actgatattctaagctatctgaaacccgactgtattccatggggaagtgttgtcagtgct
gtcctagaaatagatgactcctttactcccttagtacgtgggttcgggcacttagtaccg
cgtacggaagatgagcatattttgggtgtaatatacgattcctttgcattcccgaaattg
gatggatttaataaaaaattacgatatacagtgatgatgaaaccacttcgtgaatggctc
gaagcctccacaagtttaggttcctcagagcacctggaaaacaccattgaaaaagttgca
aaaaccgtccttataaaccatcttaaaataccggatccggtcattgttggtcgtcatatt
agtattctccgtaactgtattccccagtatcctccaggtcatttaactaatatggctaat
ttgcgcaacggcattcggcgaatttcgagtggccatagttctggccgaagtggtatatat
cttgttggtaattcgtacgatggggttgggttgaatgatgctgtctatagcgctgcgtgt
gcagttgcagaagagttcagttcatcttcctga

DBGET integrated database retrieval system