KEGG   Schistosoma mansoni: Smp_069960Help
Entry
Smp_069960        CDS       T01095                                 

Definition
ubiquitin-specific peptidase 5 (C19 family)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Smp_069960
Peptidases [BR:smm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Smp_069960
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Smp_069960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 916 aa AA seqDB search
MSESIFEDLSAQVRIPGDGEKVFKDECPFSFETPETEKGIYICMRHFVAIGSKTLRLYYE
KTGCRAFLRYKIEKQFKDKGTSAQERPTKLAVGVSGGFDFPQDMYTVTEHWSLVRLPQGD
SFDIPNPEPGQGQSDISHLEILELPKRLATSIALIQRAESVLLAEERANSLKAWEDDNIC
FISSYAMNLAQINNSVRIPPSGWKCAKCDLRDNLWMNLTDGTILCGRKFWDGSGGNNHAL
EHYEKTKYPLAVKLGTITPKGGEVFSYPEDSMVTDPKLAEHLAHFGIDVMLMQKTDKTMA
ELEVDANERLGEWLTLQESNHTLEARYGPGMTGLRNLGNTCYMNAVLQVLFSISQFRSYY
AYQLPVWCEEALDQFTSENHPLLPVDHIGLQFSKLGHGLCSGAHSWLVPNNFSHTTTGGP
VPILPGIRPILFRRLMGAHNSTFATRQQQDACEFLIYLLDLLEQKANKQEHGKVHPSNVM
RFGVEERLQCGLTNKVSYKTDHEWILSVPVPMEAVTNQKALDNYEKRRADAELNGIHLSP
EEVVRPIIPMEACLSAWAQTERITDFKTPASQPPGAKTFALRSNRLTNFPNYLCIQVGRF
TVGTDWLPKKLDVDIELKSSVGNHGNTEWFIDLNNLRAPNGSRPLPGEQLMPTGDEIKSE
QMKIDDDVQSDVTIINDLLVMGFTLEAAQKACKFTQNSSVENATNWLMEHLDDPDLNDPL
PPPSDYQQQNKQKQSVVGSVTSTDIDENAVEMMLAMGFSRQQSIVALQHKNGNLEQAADW
ALSSPDELETLLLQSEINMTNKSSADAGNNSSQTSSSSSGPLLSDGSSKYELFAFISHMG
KSTNDGHYVAHIKRSFLAKCIPHEPPVYHVGSPICGGSDQEWIIFNDEKVAKSECPPHRH
AYLYFFRRLDATDQSD
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaatctatttttgaggacttatctgctcaagtcaggattcctggtgacggggaa
aaggtattcaaggatgaatgtccgttttcgtttgagacacctgagacagaaaaaggaata
tacatatgcatgcgacacttcgttgcgatcggctctaaaacacttaggctttattatgag
aaaactggctgtcgtgctttcctaagatacaagatcgaaaagcaattcaaagataagggt
actagtgctcaagaacgcccgacaaaactcgccgttggagtttctggaggttttgacttt
ccccaagatatgtatacagtcactgaacattggtcgctagtacgtcttccgcaaggcgac
tcatttgatatcccgaatccagaacccggacaaggacaatctgatatatctcacttagag
attttggaactccctaaacgcctggctacttcgatcgcattaattcaacgtgctgagtca
gtattactagcagaagaacgagctaactcacttaaagcttgggaagatgataatatttgt
tttatttcctcgtatgccatgaatttagcacaaataaataattctgttcggattcctccg
tctggatggaaatgtgccaaatgtgatttgagagataatctgtggatgaatcttactgat
ggaaccatactttgtggccgaaaattttgggatgggtctggagggaataatcacgctctg
gagcattatgagaagaccaagtatccactagctgtcaaacttggaactataactccgaag
ggtggagaagtgttttcatatcctgaagattcaatggtaaccgacccaaaattagcagaa
catcttgctcacttcggtattgatgtaatgcttatgcaaaaaaccgataaaacaatggcc
gagttagaagtggatgcaaatgaaagacttggagaatggctaacattgcaggaatccaac
catacacttgaagcacgttatggtccaggtatgactggacttagaaatctcggtaatact
tgttacatgaatgctgtgttacaggttctgttttcaatttcacaatttcgttcgtactat
gcctatcaattaccagtttggtgtgaggaagcattggatcaattcacttctgaaaatcat
ccacttctaccagtagatcatattggtctacaattttcgaaattaggacatggtctttgt
tcaggcgctcattcatggctagttccaaataattttagtcatactactacaggtggccct
gtgcctattctcccgggtatacgtccaattttgtttcgtcgattaatgggtgctcataac
tccacatttgccacaagacagcaacaagatgcttgcgaatttttaatatatctattagat
ttattagaacaaaaagccaataaacaggaacacggaaaagtacatccaagtaatgtgatg
cgttttggtgtggaagaacgcctacaatgtggtttgacaaataaggtctcgtacaaaact
gatcatgaatggattctttcagttccagttccaatggaagcggtaacgaatcaaaaagca
ttagacaattatgagaaacgacgtgctgacgctgagttaaatggtatacatttatcacct
gaagaggttgtacgaccaattattcctatggaagcttgcctgtcggcttgggctcaaaca
gaacgaattactgattttaaaacaccagcaagtcaacctccaggtgccaaaacattcgct
ttacgttctaatcgtttaacaaattttccaaattatttatgtatacaagttggacgattt
actgttggtacagattggcttccgaaaaaattggatgtggacatcgagttgaaatcatct
gttggaaatcatggtaatacagaatggtttattgatttaaataatttacgtgcaccaaat
ggtagtagaccgttgcctggtgaacaattgatgccaactggagatgaaataaaatctgaa
caaatgaaaattgatgatgatgtacagtcagatgtaacaattatcaatgatctgttagtt
atgggtttcactttagaagcagcacagaaagcttgtaaatttacacaaaatagtagtgta
gaaaatgctaccaactggttaatggaacatttagatgatccagatttaaatgatccgttg
ccgccgcctagtgattatcaacaacaaaataaacagaaacaatcagtggttggatcggtc
acttctacagatattgacgaaaacgcagttgaaatgatgttggctatgggattcagtaga
caacagtcaatcgtcgcattacaacataaaaatggtaatttggaacaagctgctgactgg
gcattgagtagtccagatgaattagaaactttattacttcagtctgaaataaatatgact
aataaatcttccgctgatgctgggaataattcaagtcagacatcatcatcttcatcaggt
ccattgctatcagatggtagttcaaagtatgaattattcgcttttattagtcatatggga
aagtcgaccaatgatggtcattacgtagctcatattaaacgatcatttctagctaaatgt
attcctcatgaaccgccagtatatcatgttggctcaccaatttgtggcggttccgatcaa
gaatggattatattcaatgatgagaaagtagcaaaaagtgaatgccctccacatcgtcat
gcttatttatatttctttcgaagattagatgctactgatcagtctgactaa

DBGET integrated database retrieval system