KEGG   Schistosoma mansoni: Smp_070190Help
Entry
Smp_070190        CDS       T01095                                 

Definition
gcn5proteinral control of amino-acid synthesis 5-like 2 gcnl2
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
smm  Schistosoma mansoni
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Smp_070190
Enzymes [BR:smm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Smp_070190
Transcription machinery [BR:smm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Smp_070190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 899 aa AA seqDB search
MDSSTLYQKLSRYLPYSKCENEGCKCSTWKLSDNAIDEKLIEAICENCCHVHYSLFDPSE
STWLNSAMQMVDDVERMYILCTKEEDYETRNIYFCILKRLRKALMNKVQPVFDDKPPFER
PDINTAVRNALLFCALTDPQNPEITIELCKLFLAYVNSYKITYPSQRIQKYENKTGYKLI
YMRWICHCYVPKFCNALPYTEATCAFGKNFLLAVLPEIKRRLVEFFKQDSIIPSILDAKI
HLIQPLTRLCNLLEDNIDDKTTSVWDPYFQPPLRPDNVITPSGLLQSISIDHVVNFSTHQ
RNIIISSSSELKSDSVVTPALTDLKVERLFSNPDLVNGDRDMVVNTPIKSEPEESFTKPA
KITDHSTHRRTSIRLRSQLSTNTQSSVSDSEKPNCKSEDKAVVTDSNMKKSLNDNLNILD
VNSTELEQILQEMKNNESPCKGFYPFQTLHSLNATRDAAARQEESAGNIEFHIVNNSLNP
NQPPQTYIWLLELLNVFALQLPRMPKEYIARLIFDPKHKNLILLKVSDSCEKHAIGGICF
RMFPSQGFTEIVFCAVIFNEQVKGYGTQMMNHLKDYHLQHKIFHFLTYADSFATGYFRKQ
GFSREIRLARQAYLGYIKEYEGATLMGCELYPNIIYTRFSELIAKQKQVITRLIEKRRES
ANQSYPGIPAKLFRNGPLRPDQIPGLTEIDLTSNKLSDLFHKIPKTELSEINQTYINNHV
SVKRKSSDTFGKSVEKLHEPPRKLRKRLLDSLPSPSPLTTKPQTKARISSRSTRYNGSLK
ISDSLEPDWIQGAKQLAEKIRPILNALRSHILSGPFQKPVTLDEAPDYYDIIVFPIDLGT
MWERLKSNYYVTKSLFIADMMRMFHNCRTYNQQDSYLYRSANTLERYFINKMKEADLWP
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggatagttcgactttatatcaaaagttgtcaagatatttaccttattctaaatgtgaa
aatgaaggttgcaaatgtagtacatggaagctctcagacaatgcgatagatgaaaaactc
attgaagctatatgtgaaaattgctgtcatgttcattatagcttgtttgatccaagtgag
agcacgtggcttaatagtgcaatgcaaatggttgacgatgtggaacgaatgtatatttta
tgtaccaaagaagaagattatgaaacaagaaatatatatttctgtattttgaagcgcctt
cgtaaggcgttaatgaataaagtacaacccgtatttgatgacaaacctcctttcgagcga
cctgatatcaataccgccgtacgaaacgcgttactattctgtgctctcaccgatcctcaa
aatccagaaataacaattgaactgtgtaaattattcttagcatatgtgaattcatataag
atcacatacccaagtcaaaggattcagaagtatgaaaataaaacaggatacaaattaata
tatatgaggtggatatgccactgttatgtgccaaagttttgtaacgccttaccatatact
gaggctacatgtgcatttggaaagaatttcttgttagccgttttgcctgaaattaaaaga
agactagtcgaatttttcaaacaggattctataattccgtccattctggatgcaaagata
catttaatacaacctttaacacgactgtgtaatttgctggaagataatattgatgacaaa
acgacttccgtctgggatccatattttcaaccaccattgcgtcccgacaatgtaatcaca
ccaagcggattattacagtcgatttctattgaccacgtggtcaatttctctacacatcaa
cgtaatataatcatcagtagttcaagtgaactgaaaagtgattcagttgttacaccggct
ctcactgatctaaaagtggagagactgtttagtaatccagatttggtgaatggtgatagg
gatatggtagttaatacacctattaaatctgaacctgaggagtcatttacaaaacctgcc
aagataactgatcattcaacgcaccgaagaacaagtatacgtcttcgaagtcagttatcg
actaatacacaatcgtctgtaagtgattcagaaaaaccaaactgtaaatcagaagacaaa
gctgtagtcaccgatagcaatatgaaaaagtcattgaatgataatttaaatattttagat
gttaatagtacagaattagaacaaattctacaagaaatgaaaaacaatgaaagcccttgt
aaaggattttatccgtttcaaacgcttcattcattaaatgcaacaagagacgccgctgca
cgtcaagaagaatcagctgggaatattgaatttcatatagttaataatagtttaaatcct
aatcaacctccacaaacatatatttggcttttggagttattaaatgtatttgctttgcaa
ttacctcgtatgccaaaggaatacattgcacgacttatttttgacccaaaacacaaaaat
cttattttgttaaaagtttctgattcatgtgaaaaacatgctatcggcggaatctgcttt
cgtatgtttccatctcagggatttacggaaattgtgttttgtgcagtaattttcaatgaa
caagtaaaaggttacggaacacaaatgatgaatcatttaaaagattatcatttacaacat
aaaatatttcattttcttacatatgctgattcatttgctactggttattttagaaagcaa
ggattttcacgtgaaatacgcttagctcgacaagcttatttaggttatattaaagagtat
gaaggtgccacattaatgggttgtgaattatatccaaatattatttatactagattttct
gaattaattgcaaaacaaaaacaggttattacccggttgatagaaaaacgtcgtgagtct
gctaatcaatcctacccaggaatacctgccaaactatttcgtaatggacctttaagacca
gatcaaatccctggtctaactgagatcgatctgacttcaaacaaactttctgatttattt
cataaaattcctaagacagaattatccgaaatcaatcaaacttacataaataatcatgtt
tcagtgaagcgaaaatcgtcagatacttttggtaaatctgttgagaaattacacgaacct
ccaaggaaactacgcaaacgtttactcgattctttgccaagtcccagtccgctgaccaca
aagccacagacgaaagcaagaatcagttcaaggtcaacgcgttataatggctcattaaaa
atatcagattcattggaacctgactggatacaaggagctaaacagctagcagaaaaaatc
cgtcctatcctaaatgcattacgtagtcatatattgtctggcccttttcaaaaacctgtt
acattagatgaagctccagattactatgatattattgttttcccaatagatttgggcaca
atgtgggaacgtttaaaatcgaattattacgttacgaaatccttgtttattgctgatatg
atgcgaatgtttcataattgtcgtacttacaatcaacaagactcttatctttatagaagt
gctaatactttagaacgttatttcatcaacaaaatgaaagaggctgacttatggccttaa

DBGET integrated database retrieval system