KEGG   Schistosoma mansoni: Smp_072980Help
Entry
Smp_072980        CDS       T01095                                 

Definition
eukaryotic elongation factor 2 kinase (eef-2 kinase) (EC:2.7.11.20)
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
smm  Schistosoma mansoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 863 aa AA seqDB search
MGSYIDEVTDDNLNISEVTLQSDASMSEQQNALILWQRAFKKVKSIDLDSWSNLPWDKCP
VRCALRHRYSAIKKKWVVDEVRIKMESEPFDRGAMRECFRMKKQSQRATDTNDWHHTSNY
VAKRYIAPTDKQIYFDDVRLQMEAKLWGEAFNRHNPPKKVDIFQLSVLELSPDSSVGTEK
VDFSPAFFHIERFMEGEYRKYNSNSGFVDECLRNTPQTFSHFTFERSGHRLLVVDIQGVG
DLYTDPQIHTSDGVGYNDGNLGTRGMALFFHSHRCNPLCKWLGLAQFDLAPSELDEPMQC
QQTDQNPPNPAEEEVNQVDLSTYGMFRKSKFRRRTISLNNQMSCKSPSQLYGPTVVRSSE
SMLMSLLSETRRRCASVSLCDHSKSVGQSSDCVSSFHSVGDGLSFDSYDALKLRETSCLD
PPFQLSSRQLSPDLNISGQGQICPQPIQNFSSVVPKQPDSRNRAASGDSGYVGRINLIQP
CSDLPVSRSHEIASGFDQNCMNLSGDSTSVDLSVRISQPNVLGMRSLESHSLVDEAFPTG
PNYSISNRSIFIPKRQRNISESSDVDAEECHRVTGNLLYQLMHENHKPSCADHPTNLDQE
IGHSILGQIHHELARLHEAGRFIPNKGHWSHVGLGGEGIFNKDSCEVSEFEESHNEANND
PVTLIDWSAVLFHERHAAQLGCLEAMIVMAHYYLGLPTQLLLECPIKDLSVNFLNPEHQF
NFTTTSRDILMLPALQSFLNNDSHSLLSSISPDSWSEAVVWYKRAVDSAMGSSTSGDGCT
DEGLDAEGHYDAAEDLLPVYRILARMAEMYSVGGFGLKQNFSLAGDLFTQAAEIASSALQ
GRLAARYFELADEAYLTNEQITN
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgggatcttatattgatgaggttactgatgataatttgaacatctctgaagtaacactg
cagtcagacgcttctatgagtgaacaacaaaatgcccttattctatggcaaagagcattc
aagaaggttaaatcaatagacctggactcatggagcaatctaccatgggataaatgtcct
gttcgatgtgccctcagacaccggtacagtgcaatcaagaagaaatgggttgtggatgaa
gtgcgaatcaaaatggaatcggaaccgtttgatcgtggagcaatgcgggaatgctttaga
atgaaaaaacagagtcagagagcaacggataccaatgactggcaccatacttcaaattat
gtggccaagcgatacatagcccctacagacaaacagatttattttgacgatgtacgtcta
caaatggaagcaaagttatggggtgaagctttcaatcgtcataatcctcccaaaaaggtg
gatatcttccagctgtctgttctcgaattgtctcctgacagttctgttggcactgaaaaa
gtagatttttcaccagcattttttcatattgaacgctttatggaaggagaatatcgtaaa
tacaactcaaattctggcttcgttgatgagtgtttacgtaataccccacagacctttagc
cacttcacatttgaacgttctggtcaccgattgttagtagtagatatccaaggtgttgga
gacttgtacactgatcctcaaattcatacatcagatggagtgggctacaatgatggcaat
ctaggtacgaggggtatggctttattcttccatagccatagatgtaatcctttatgtaaa
tggctaggattggctcaatttgatttggcaccctctgaattagatgagccaatgcagtgt
caacaaactgatcaaaatccacctaaccctgcagaagaagaagtcaatcaagttgacctg
agtacatatgggatgtttcgcaaatcgaaatttcgtcgacgcacaataagtctaaataat
cagatgtcctgtaaatccccatctcaattatatggtccaacagttgttcgttcatcagag
agcatgctcatgtcgttactttctgaaactcgccgtcgttgtgctagtgtctcactttgt
gatcattctaaatccgtaggacaaagttcggattgtgtatcatctttccattcggtaggt
gacggtctttcatttgacagctatgacgctctgaagctacgtgaaacatcatgtctagat
cccccttttcagctgtccagccgccaactttcacctgatttaaatatatctggtcaggga
cagatttgtccacaaccaatacaaaatttcagttcagttgtccccaagcaaccagattcg
agaaaccgtgcagcatctggtgactcaggatatgtgggacgaattaatttaatccaacct
tgttccgacttacctgttagtagatctcacgaaatcgcttctgggttcgatcaaaactgt
atgaatcttagtggtgattctacctcagttgatttgtcagtacgtatatctcagcctaat
gtcctgggtatgcggtccttagaatcacattcattagtggatgaagcctttcctacagga
ccaaattattcaatttccaatcgtagtatttttatccccaaaagacagcgtaatattagt
gaatctagtgatgtagatgcggaagaatgtcatcgtgtgacaggaaatttgttgtatcaa
ctaatgcatgaaaatcacaaacccagttgtgccgatcatcctacaaacttggatcaagaa
atcggccattcaattcttgggcaaatacatcacgaacttgctagacttcatgaagctgga
cgtttcattccaaataaaggtcattggtcacatgtaggattaggaggtgaaggaattttc
aacaaagactcttgcgaagttagtgagttcgaagaatcgcataacgaagcaaataatgac
ccagtaactttgatcgactggtcagctgtcctatttcatgaacgtcacgctgctcagcta
ggctgtctggaagccatgatcgtcatggcacattattatcttggtttaccaactcagctg
ctactggagtgcccaataaaagatttgtcagttaatttcctaaatccagaacatcaattc
aacttcacaacaacctcgcgtgatatacttatgcttcctgctttacagtcgtttcttaac
aacgatagtcattcattactttcctccatatcccctgattcgtggtccgaagctgtagtg
tggtataaacgagcagtcgatagtgcgatgggttcatccacttccggtgatgggtgtaca
gatgaaggtttagatgcggaaggtcactacgatgctgctgaagatttgttaccagtttat
cgtattttggctcgtatggctgaaatgtattctgtcggtggcttcggtcttaaacaaaat
ttttctttagctggagatctattcactcaagctgcagaaattgcgtctagtgctttacag
ggtcgtttggctgcaagatattttgagttagcagatgaagcatacttaacaaatgaacaa
attacaaactga

DBGET integrated database retrieval system