KEGG   Schistosoma mansoni: Smp_074400Help
Entry
Smp_074400        CDS       T01095                                 

Definition
ubiquitin-specific peptidase 22 (C19 family)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Smp_074400
Peptidases [BR:smm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Smp_074400
Transcription machinery [BR:smm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Smp_074400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 489 aa AA seqDB search
MPEMSCKHANQFFTQKTNEIAYKNIINHIAFPKSQRGFTHKATLCCTLCKTRGEDFDVCN
KDLIRPGCLLACAHCIHFACWDYRHIYLHGEDHPDHYLSVCTERGELFCTGCGDFVYHSV
AETFHQSACRTYLAQFGLSNRYWRPSFNELRLIPHITPVLPLTVNGCSGAMRGLINMGNT
CFLNVVIQALTHTPVLRDYLLADLHRCSSPTRSRNCLACEMVRITQELYKPVVTPFVPNN
LLYAIWLHASHLAGYEQRDAHEFLITLLTLIHGHLVGEESPHDHDVSSSRESSDSCDCIV
HQVFFGDLESVISYEGCEHRSSTVDPFLDLSLDVIQRGSTSLQACLGSYFRPELIDGLIW
CSQCNIGRPAVKQFSLLHLPNVLCFYLKRCHHDTKINTSITFPVELDMAPYLHQIVGDQS
AWYDKYSLYAVLNHSGQTNSGHYTAYIRVGPTSWCLCDDQKVVSVNLNDVLHTDAYVLLY
HKNLLAIRI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaatgtcttgcaaacatgcgaatcaattcttcacacagaagacaaatgagatt
gcatataaaaatatcattaaccatattgcttttccaaagtcccagcgtggattcactcat
aaggctacattatgttgtactttatgcaaaacacgaggtgaagatttcgacgtttgcaat
aaagatttgataagacctggatgtttactcgcatgtgctcattgtattcatttcgcttgt
tgggattatcgtcatatatatttacacggagaagaccatcctgatcattatctttctgtt
tgtacagaacgtggtgaattattttgtactggttgtggtgattttgtttaccattctgtg
gctgaaacttttcatcagtctgcatgtcgcacttatttagctcaatttggtttatccaat
cgttattggagaccatcgtttaatgaattacgtctaatacctcatattactccagtatta
cccttaactgtaaatggctgctctggagctatgcgtggtcttatcaatatgggtaataca
tgcttcttaaatgttgtcatacaagcgttgacccatacacccgttttacgtgactatttg
ttggctgatttacatagatgttcaagtccaactcgatcgcgtaattgtttagcttgcgaa
atggttcgcattacacaagagttatataaacctgttgttactccatttgtaccaaataat
ctactgtatgcaatttggttacacgcaagtcatttagctggttatgaacaacgggatgct
catgaatttcttataacattgttaactttaatacatggtcatcttgttggcgaggaatca
ccacacgatcatgatgtatctagttctcgtgaaagttccgattcttgtgattgtattgtt
catcaggtgttttttggtgatttggaatctgtcatatcctatgaaggttgtgagcataga
tcatcaacagttgatccattcttagatctttcattagatgtaattcaacgtggttctact
tcattgcaagcatgtcttggatcctattttcgaccggaattaattgatggtttaatatgg
tgttcacaatgtaatattggtcgaccagctgttaaacaattcagtttacttcatttacct
aatgttttatgcttttatctcaagcgttgtcatcatgatacaaaaatcaatacatcgatc
acattccctgttgaattggacatggctccatatttacaccaaattgtcggcgatcaatca
gcttggtatgataaatattcattatatgctgtattaaatcatagtggtcaaactaattct
ggtcattatactgcttatatacgtgttggtccaacatcatggtgtttatgtgatgatcaa
aaagttgtatcagttaatttaaatgatgttttacatacagatgcatatgtattattatat
cataaaaatttattagctatacgcatttaa

DBGET integrated database retrieval system