KEGG   Schistosoma mansoni: Smp_078900Help
Entry
Smp_078900        CDS       T01095                                 

Definition
enhancer of zeste ezh
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Smp_078900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 1026 aa AA seqDB search
MVRRSSYVNRDCKNNKSSPNEIVPVCESRRTRVKSLRRRPTSSNRPYYNPCERRRRLQTM
IREVYSRIRCANLTSKWNHVFELMSKNRRLLSEQLNSAYTANLSARSITCDEMWPNSSST
DPPLLAEPVEIPNVYSQFGKFEARIGGVSYRVAITMMPQVDPVPSVCMWAPVQHNFSVED
ETELANLPYMGDDQAQEDVNFLEELLNNYDGHLHGNFPFEFEESLLVQLVNAVAKAWPDI
TTKCGLIPLTNQKDEHSPIDLSQNPIAIDNSSPKEIDSSSMIGIVDETDLVHSNCKSNER
TLKRSKPDEEDSDEVLTIKKGRFTRRSGFIEIKDVEVTISSDIIPPNISINLPEFNDKAL
VNLHKKLKIEDDDKEVKCELIASTQQSPKIRNSVDSHHSDRDSNSPDPKRLSSTGIPEGV
FSAIAGTFGSSDDSSKLQLRYMELKERSSTSQLNEEALTCCPNLDNPIEVLNAVKSGRHQ
IPTRAEALHSFRTLFCRRCFKYDCALHPYKSTQSMWSHRWPFVASTNVESDAPYCGVWCV
RQFTDKQNHHHNNNNRINERDCDWNPVEISLYQVLAPMYIPYGYSSYHLYNWCCTLSNLI
GTKKCSEVLSYASAQNHSTLLLPDSGQLSQLRVPGTGIEWGRRSTSTASLNDGGDCAGSG
SCSGSVQDNGEFTEEAMNNNNESSSYNLLPSYRRKRSRKRRLKKSMLLGPPTRRLDDDED
SQTNACHQNATNGNSNGVVASGCFAHHYHPCDHPGQRCDDSCSCRIAGTFCEKFCQCPPD
CPNRFLGCRCRGQCNTKLCPCVLAVRECDPDLCLSCGAHSSFRSFASGNSMDLLSLLQTT
LPPVTGTCRNVAIQRGWRKHLLMAPSDVAGWGIFIKEAAEKNDFIYEYCGEIISQDEADR
RGKIYDKTMSSFLFNLNRDFVVDATRKGNKIRFANHSVNPNCHAKVIMVNGDHRIGIFAK
RAILPGEELFFDYRYGPTEQLKYVGIERDTDAASVINNPLCVLNTSGGDLNPLCSNIPLN
NCIEIP
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtcgatcttcatatgtaaatcgtgattgtaaaaataataaatccagcccaaat
gaaatagttcctgtatgcgagtctcgcagaacccgtgtgaaatcactgagacgaagacca
actagttcaaatagaccgtactacaatccatgtgaacgtcgtcgtcgtttacaaacaatg
atccgtgaggtctacagtcgtattcggtgtgctaatttaacatccaagtggaatcatgta
tttgaattgatgtcgaagaatcgacgtttgttaagcgaacaactgaattctgcttatact
gctaatctttcagctcgatctatcacctgtgatgaaatgtggcctaattccagttctacc
gatccacctttattagctgaaccggtagaaattcctaatgtctatagtcaatttggcaaa
tttgaggctcgaatcggtggtgtatcttatcgtgttgctattacaatgatgccccaagtt
gatcctgtgccttctgtttgtatgtgggctcctgttcaacataatttctctgttgaagat
gagacagaattagctaatttaccatatatgggtgatgatcaagctcaagaagatgtgaac
tttttagaagaacttttaaacaattatgatggtcatttacatggtaattttccatttgaa
tttgaagaatcacttctggtacaattggttaatgcagttgctaaagcatggccagatatt
accacaaaatgtggattaataccacttacaaatcaaaaagatgaacactcacccatagat
ttatcacaaaatccgattgcaattgataattcgtcaccaaaagaaattgattcatcatca
atgattggtattgttgatgaaactgatctagttcattctaattgtaaatcaaatgaacgt
accttgaaaagatcaaaaccagatgaagaagatagtgatgaagttttaactataaaaaaa
ggtcgtttcacccgtcgttcaggatttatcgaaattaaagatgtcgaagtaacaataagc
agtgatataataccgcctaatatcagcattaatctcccggaattcaatgataaagcattg
gttaatctccataaaaagctgaaaattgaagacgatgataaggaagtcaagtgtgagctg
atcgctagcacacaacaatctccgaagataagaaattccgttgattcacatcatagcgat
cgtgattcaaattctccagaccctaagcgtctcagtagcactgggattccagaaggagta
ttctctgccatagctggaacattcggttcatcagatgattctagtaaacttcaacttcga
tatatggaattgaaagaacgttcaagtacttcacaactgaacgaggaagcgttgacatgc
tgtccaaatttagacaatccaattgaagttctgaatgcagtgaaaagtggtcgacatcaa
attcctacaagagctgaagctttacattcatttagaacattattttgtcgtcgatgtttc
aaatatgattgtgctttacatccttataagtctactcaatcaatgtggagtcatcgttgg
ccatttgttgcatcaactaatgtggaatcagatgctccatattgtggtgtatggtgtgtt
cgtcaattcactgataagcaaaatcatcatcataataataataaccgaataaatgagaga
gattgtgattggaacccggtcgaaataagcctatatcaagttttagctccaatgtatata
ccatacggttattcttcatatcatttatacaattggtgttgtacattatctaatcttatt
ggaacaaaaaagtgttcagaggtgcttagctatgcaagtgcacagaatcattcaactctt
ctacttcccgattctggacaattaagtcaactacgtgtacctggaactggtattgaatgg
ggtcgacgttcaactagtactgcatcgttaaatgatggtggagattgtgccggatctgga
tcatgcagtggaagtgttcaggataatggtgaattcaccgaagaagctatgaataataat
aatgaatcatcgagctataatttactaccatcatatagacgaaaacgttcaaggaaacgt
cgtctaaaaaagagcatgttattaggaccaccaactcgtcgtttggatgacgatgaagat
tcacaaaccaatgcatgtcatcaaaatgctacaaatggtaattctaatggtgtagttgca
agtggttgtttcgctcatcattatcatccatgtgatcatcctggtcaacgatgtgatgat
tcttgttcttgtcgaatagctggaacattttgtgaaaagttttgtcaatgtcctcctgat
tgtccaaatagatttttaggatgtcgttgtcgaggtcaatgtaacacaaaattatgtcca
tgtgttttagctgttagagaatgtgatccagatttatgtttatcttgtggtgcacattca
tcttttcgatcatttgcctctgggaattctatggatttactttcactgcttcaaactact
ttacctcctgttactggaacttgtcgaaatgttgccatacaaagaggttggcgtaaacac
cttttaatggcaccttctgatgtagctggttggggtatatttattaaagaagctgcagag
aaaaatgatttcatatatgaatattgtggtgaaataattagtcaagatgaagcagaccga
cgaggtaaaatttatgataaaacaatgagcagttttttgttcaatcttaatcgagatttt
gttgtggatgctacacgtaaagggaataaaattcgatttgcaaatcattcagttaatcct
aattgtcatgctaaagttatcatggtgaatggtgatcatcggattggtatttttgcaaaa
cgtgcgattctccccggtgaagagttattctttgactaccgttatggtccgacagagcaa
cttaaatatgtaggtattgaacgagatacagacgctgcaagtgtaatcaataatccttta
tgcgtattgaatacatctggcggtgatcttaaccccctatgctccaatataccgcttaat
aactgcattgaaattccttag

DBGET integrated database retrieval system