KEGG   Schistosoma mansoni: Smp_079770.1Help
Entry
Smp_079770.1      CDS       T01095                                 

Definition
protein disulfide-isomerase er-60 precursor (erp60) (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
smm  Schistosoma mansoni
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Smp_079770.1
Enzymes [BR:smm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Smp_079770.1
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Smp_079770.1
  Exosomal proteins of colorectal cancer cells
   Smp_079770.1
  Exosomal proteins of bladder cancer cells
   Smp_079770.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 484 aa AA seqDB search
MRWLLSCLFLVAFASCSKVLELTKDNFHSELKSIPVALVKFYAPWCGHCKKLAPEFTSAA
QIISGKTNDVKLVKVDCTTQESICSEFGVSGYPTLKIFRNGDLDGEYNGPRNANGIANYM
ISRAGPVSKEVSTVSDVENVLSDDKPTVFAFVKSSSDPLIKTFMALAKSMVDDAVFCHSH
NNLFVTPSDNELRVYLPKRLRTKFEDDFAVYKGELESNNIKDWIRKHGQGLVGYRSPSNT
FYFENSDLVVLYNNQSIDSYPSGVKYLRNRVLKTLKDNPQKFKNLVFAYSFADDFSYEIS
DYGIEADKLPAVVIQSKDKKYKLEKFSLDAFSDFLNKFEDGLLTPHVKSEPLPTDDSSAV
KKLVALNFDEIVNNEEKDVMVVFHAPWCGHCKNLMPKYEEAASKLKNEPNLVLAAMDATA
NDVPSPYQVRGFPTIYFVPKGKKSSPVSYEGGRDTNDIIKYLAREATEELIGYDRSGNPK
KSEL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggttgctgtcgtgtcttttcctcgtcgcatttgcgtcgtgtagcaaggtcctt
gagctcactaaagacaatttccattctgaattaaagtccataccagttgctctggtgaag
ttttacgctccatggtgtggacactgtaaaaaactagctcctgagttcacttcagccgca
caaattatatccggaaaaactaacgatgttaagctcgttaaggttgattgtactactcaa
gaaagtatctgctcggagttcggagttagtggctaccctactctgaaaatcttcaggaat
ggagatttagacggtgaatataatggtccaagaaatgcaaatggaatcgccaattatatg
atatcccgagcaggacctgtatccaaagaagtcagcactgttagtgatgtagagaacgtc
ttgtcagacgacaagccaactgtgtttgcttttgtaaaatcgtctagcgacccgttaata
aaaacattcatggctcttgcaaaatcaatggttgacgatgctgtattttgtcatagtcat
aataatctttttgtaactcctagtgacaacgagttgagagtctacttgcctaaacgtctt
cgaacgaagtttgaggatgacttcgctgtttataaaggagaacttgaatctaacaatatt
aaagactggattcgcaaacatggccagggactggttggttatagatcaccgtcaaataca
ttttacttcgaaaattccgatttagtagtattatacaataaccaatccatagattcatat
ccatctggagtaaaatacctaagaaatcgtgttctcaaaacccttaaggacaacccccaa
aaattcaagaatttggttttcgcttatagctttgcggacgatttttcttatgaaatatct
gattatggtatagaagcggataagttaccagcggttgtaatccaatctaaagacaaaaag
tacaagcttgagaaatttagtcttgatgccttctctgattttttgaataaatttgaagat
ggtcttttgaccccacatgtaaaatcagaacctctcccaacagacgactctagtgcagtc
aaaaagttagttgcactcaactttgatgagatagtaaataacgaggagaaagatgtaatg
gtcgtctttcatgctccttggtgtggtcattgtaaaaatctaatgccaaagtacgaggaa
gcagccagtaaactaaaaaatgaaccaaatttggttttggctgctatggatgcaaccgcc
aatgatgtcccttcgccttatcaagtcaggggattcccaactatctatttcgtccctaaa
ggaaagaaatcttcacctgtatcttacgagggtggtcgagacactaatgacatcatcaag
taccttgcacgcgaagctactgaagaacttattgggtacgacagatcaggcaatccaaag
aaaagtgaactatag

DBGET integrated database retrieval system