KEGG   Schistosoma mansoni: Smp_079840Help
Entry
Smp_079840        CDS       T01095                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
smm  Schistosoma mansoni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Smp_079840
Enzymes [BR:smm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Smp_079840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 250 aa AA seqDB search
MYVVLLKSAGENATSISDDPYVQILKNSGFTVDLLETLDFEYNISNLAEYKNWRNNHSCI
IFSSPRSVIACVKAGLTGNENDLCFVVGPSTELQAKKAGFLPKGAESGDAEKLASFILKH
FASKLDKPIFFPCGQVHRDTLPKVLENEGKKVNIITAYSSVENTQLHEKLRLNLCEGNPI
PECLVFFSPSGVSLTENILLTEIKPHRPNIKLVAMGRATATRLKELGLTVSAVASSPKPE
SLLTALKQLK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtagttctccttaaatcggctggtgaaaatgctactagcatcagtgatgaccct
tacgtacagatattaaaaaattcaggtttcactgtagacttgctggaaactctagatttc
gagtataacatatcaaatctagcggaatacaaaaattggaggaacaatcacagttgcatt
atttttagtagcccacgttccgtaatcgcttgtgttaaagctggactaacaggcaatgaa
aatgacctttgtttcgttgttggtcctagcactgagttacaagctaaaaaggctggattt
ttgcctaagggagcggaatctggtgatgccgagaagctcgcaagttttattttgaaacac
tttgcctcaaaactggataaacctatattttttccatgtgggcaagtacaccgcgacaca
ctaccgaaagttttggaaaatgaaggaaaaaaagtaaatatcattacggcttattcctct
gtggaaaatactcaacttcatgaaaagttgcgattgaatttatgtgaaggaaatcctatt
cctgaatgcttagtatttttcagtccttctggcgtttcattgactgaaaatatattatta
actgaaattaaaccacatcgaccaaatattaaattagttgctatgggacgcgcaacagca
acaagattgaaagaattaggtttgaccgtttcggcggtcgcctcatcacctaaaccggaa
agtctactaacagcattaaagcagttaaaatga

DBGET integrated database retrieval system