KEGG   Schistosoma mansoni: Smp_080530Help
Entry
Smp_080530        CDS       T01095                                 

Definition
replication protein A
Orthology
K10739  
replication factor A2
Organism
smm  Schistosoma mansoni
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:smm03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:smm03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:smm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smm03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:smm03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 264 aa AA seqDB search
MWSSTDYGSSIGTTSDFGGGYMASMGATTGQKKISYQGTIVPCTCAEIMAANQDGDKFVS
PCGIEFSQISVVGIIRSVNESSTRVEYEIDDYTGPCLPVKLFTEDQDNTSSGPQSRPFRE
LSYVRVHGHVRNFQGVKHVIAFRVIHLSDMNELTTHIMEVIYTRMLYTKIKQDENNGTNV
KSNFSEGGSHNAPGSISNGLTVLQNQILAIVRTFVGERGIPVSQLTEKLRGIPERQIRED
LDFLSAEGHVYSTVDDDHFRATEA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcgtcaactgactacggtagtagtattggaactacaagtgattttggtggaggt
tatatggcatcgatgggtgccacaactggacaaaagaagattagttaccagggtactatt
gttccttgtacgtgtgccgaaataatggccgcaaatcaggatggtgataaatttgtgtct
ccatgtggaatagaattcagtcaaatatcagttgttgggattattcgttcggtaaatgag
tcaagtacacgcgtagagtatgagatcgacgactatacaggaccatgtttgccagtaaaa
ctttttacagaggatcaggacaatacatcttccggtccacaatcacgtccgtttcgcgag
ttatcgtatgtacgagtacatggtcatgtccggaacttccagggagtcaaacatgttatt
gctttccgagtcatccatttgtcagacatgaatgaacttactactcatataatggaagtg
atttatacaagaatgttgtatacgaaaatcaaacaagatgagaataatggcacgaacgtc
aaaagtaatttcagcgaggggggttcgcataatgcacctggttctataagtaatggactc
actgtcttgcaaaatcagatactcgcaatagttagaacgtttgttggtgagcgtggaatt
cctgtatcccaattaacggaaaagctgcgtgggatacccgaaaggcaaataagggaggac
ttggatttccttagtgctgagggtcatgtatattcgactgtggatgatgatcacttccga
gctactgaagcataa

DBGET integrated database retrieval system