KEGG   Schistosoma mansoni: Smp_080530Help
Entry
Smp_080530        CDS       T01095                                 

Definition
(RefSeq) replication protein A
  KO
K10739  
replication factor A2
Organism
smm  Schistosoma mansoni
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Smp_080530
   03420 Nucleotide excision repair
    Smp_080530
   03430 Mismatch repair
    Smp_080530
   03440 Homologous recombination
    Smp_080530
   03460 Fanconi anemia pathway
    Smp_080530
DNA replication proteins [BR:smm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Smp_080530
DNA repair and recombination proteins [BR:smm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Smp_080530
   MMR (mismatch exicision repair)
     Smp_080530
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Smp_080530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
AA seq 264 aa AA seqDB search
MWSSTDYGSSIGTTSDFGGGYMASMGATTGQKKISYQGTIVPCTCAEIMAANQDGDKFVS
PCGIEFSQISVVGIIRSVNESSTRVEYEIDDYTGPCLPVKLFTEDQDNTSSGPQSRPFRE
LSYVRVHGHVRNFQGVKHVIAFRVIHLSDMNELTTHIMEVIYTRMLYTKIKQDENNGTNV
KSNFSEGGSHNAPGSISNGLTVLQNQILAIVRTFVGERGIPVSQLTEKLRGIPERQIRED
LDFLSAEGHVYSTVDDDHFRATEA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcgtcaactgactacggtagtagtattggaactacaagtgattttggtggaggt
tatatggcatcgatgggtgccacaactggacaaaagaagattagttaccagggtactatt
gttccttgtacgtgtgccgaaataatggccgcaaatcaggatggtgataaatttgtgtct
ccatgtggaatagaattcagtcaaatatcagttgttgggattattcgttcggtaaatgag
tcaagtacacgcgtagagtatgagatcgacgactatacaggaccatgtttgccagtaaaa
ctttttacagaggatcaggacaatacatcttccggtccacaatcacgtccgtttcgcgag
ttatcgtatgtacgagtacatggtcatgtccggaacttccagggagtcaaacatgttatt
gctttccgagtcatccatttgtcagacatgaatgaacttactactcatataatggaagtg
atttatacaagaatgttgtatacgaaaatcaaacaagatgagaataatggcacgaacgtc
aaaagtaatttcagcgaggggggttcgcataatgcacctggttctataagtaatggactc
actgtcttgcaaaatcagatactcgcaatagttagaacgtttgttggtgagcgtggaatt
cctgtatcccaattaacggaaaagctgcgtgggatacccgaaaggcaaataagggaggac
ttggatttccttagtgctgagggtcatgtatattcgactgtggatgatgatcacttccga
gctactgaagcataa

DBGET integrated database retrieval system