KEGG   Schistosoma mansoni: Smp_082790Help
Entry
Smp_082790        CDS       T01095                                 

Definition
tfiih polypeptide
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
smm  Schistosoma mansoni
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Smp_082790
  Replication and repair
   03420 Nucleotide excision repair
    Smp_082790
Transcription machinery [BR:smm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Smp_082790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 486 aa AA seqDB search
MGVHSCSSIFEYLKNVGVHMLDELYTHPPTCLVVFRELPELAKHFVMRLLFIEQPIPKSI
VSGWVEKGSIALLNDSCKALTDLRIWHSTDSNVSRGSWSLNKRYQESIRISLFGGGKPLL
GDLGVVTNDKYSKSVDFLKSYAAERWDAILHFMVGSESAEVGSVVKDVLLLSNLMKCEGN
DCPIGITKHGFHFLLMSRQFQVLVFILHYFDYLKENSKNLVGALQFVFQLSFLCPTKSYP
VEALSTAQQEVLQHMRELGLAYQRKRTAPRFYVTPLALDFAGGHTTFLESKSGGWGPQSG
VIPTGVSKSDPTDSNKMFSQISVSNSSDVGYILLETNFRLYAYTDSPLRTALLSLFSKIR
ARFPNLVVADITRDSVREALIRGITANQILSFLTANAHPDMLLQNPILPPTLTDQIRLWE
LERDRFLFQEGCLYEQFSRNTDFEMVRDYAKSIGVLLWENPERRLMVVSKAGHEDVRKFW
KHKRPS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtccattcatgttcatctatatttgaatatctcaaaaatgttggtgttcatatg
cttgacgaattgtacactcatcctccaacatgtcttgttgtttttagagaattacctgaa
ctggcgaaacattttgtcatgcgacttttatttattgaacaaccgataccgaaatctatt
gtctctgggtgggttgaaaagggttctattgcacttctaaatgactcatgtaaagctttg
accgatttaaggatatggcattctacagacagtaatgtttctcgaggctcttggtcttta
aataaaaggtaccaagaatctattcggatatcactattcggaggtggaaaacccttactt
ggagatttaggcgttgtgacaaacgataagtactcaaaaagcgttgactttttaaaatct
tatgcagctgaacgatgggatgctatacttcactttatggtaggttctgaatcagcggaa
gttggaagtgttgtgaaggatgtccttttattgtccaatttaatgaaatgtgaaggtaat
gattgtccaatcggtatcacaaagcacgggttccatttcttgcttatgagtcgacagttc
caggtgctagttttcatcttgcactactttgactacttgaaggaaaatagtaaaaattta
gttggagccctacagttcgtcttccaacttagttttttgtgtccgacaaagagctatcca
gtagaggcactgagtactgcccaacaggaagtattacaacatatgcgcgaactcggttta
gcttatcaacgaaaacgtacagcgcctcgtttctatgtaactcctcttgctttggatttc
gctggaggtcatactactttcttggaaagtaaatcaggtggatggggtccacaatcgggg
gttattcctactggtgtctcaaaatcagatcccaccgacagcaataaaatgttttcgcag
atttcagtatcgaattcttccgatgttggttacattttgctcgaaaccaattttcgacta
tacgcctatacagattcaccgcttcgtactgctcttcttagcttatttagcaaaatacgt
gcacgttttcctaatcttgttgttgctgatataacccgtgactcagttcgggaagcatta
attcgtggaataactgcaaatcagatcctatctttcttaacagccaatgcacatccagat
atgttactacagaatcctatattaccgcctactttaaccgatcaaatacgactatgggaa
ttagagcgagatagatttctatttcaagaaggctgtctgtatgaacaattctctcggaat
acagattttgaaatggttcgggattatgctaaaagtattggtgttttactctgggaaaat
cctgaacgaagacttatggttgtgtctaaagcaggtcatgaagatgtacggaaattttgg
aaacacaaacgtccgtcctaa

DBGET integrated database retrieval system