KEGG   Schistosoma mansoni: Smp_082790Help
Entry
Smp_082790        CDS       T01095                                 

Definition
(RefSeq) putative tfiih, polypeptide
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
smm  Schistosoma mansoni
Pathway
smm03022  Basal transcription factors
smm03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Smp_082790
  Replication and repair
   03420 Nucleotide excision repair
    Smp_082790
Transcription machinery [BR:smm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Smp_082790
DNA repair and recombination proteins [BR:smm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Smp_082790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 8343425
NCBI-ProteinID: XP_018650127
GeneDB: Smp_082790
UniProt: G4VC79
Position
2
AA seq 486 aa AA seqDB search
MGVHSCSSIFEYLKNVGVHMLDELYTHPPTCLVVFRELPELAKHFVMRLLFIEQPIPKSI
VSGWVEKGSSALLNDSCKALTDLRIWHSTDSNVSRGSWSLNKRYQESIRISLFGGGKPLL
GDLGVVTNDKYSKSVDFLKSYAAERWDAILHFMVGSESAEVGSVVKDVLLLSNLMKCEGN
DCPIGITKHGFHFLLMSRQFQVLVFILHYFDYLKENSKNLVGALQFVFQLSFLCPTKSYP
VEALSTAQQEVLQHMRELGLAYQRKRTAPRFYVTPLALDFAGGHTTFLESKSGGWGPQSG
VIPTGVSKSDPTDSNKMFSQISVSNSSDVGYILLETNFRLYAYTDSPLRTALLSLFSKIR
ARFPNLVVADITRDSVREALIRGITANQILSFLTANAHPDMLLQNPILPPTLTDQIRLWE
LERDRFLFQEGCLYEQFSRNTDFEMVRDYAKSIGVLLWENPERRLMVVSKAGHEDVRKFW
KHKRPS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtccattcatgttcatctatatttgaatatctcaaaaatgttggtgttcatatg
cttgacgaattgtacactcatcctccaacatgtcttgttgtttttagagaattacctgaa
ctggcgaaacattttgtcatgcgacttttatttattgaacaaccgataccgaaatctatt
gtctctgggtgggttgaaaagggttctagtgcacttctaaatgactcatgtaaagctttg
accgatttaaggatatggcattctacagacagtaatgtttctcgaggctcttggtcttta
aataaaaggtaccaagaatctattcggatatcactattcggaggtggaaaacccttactt
ggagatttaggcgttgtgacaaacgataagtactcaaaaagcgttgactttttaaaatct
tatgcagctgaacgatgggatgctatacttcactttatggtaggttctgaatcagcggaa
gttggaagtgttgtgaaggatgtccttttattgtccaatttaatgaaatgtgaaggtaat
gattgtccaatcggtatcacaaagcacgggttccatttcttgcttatgagtcgacagttc
caggtgctagttttcatcttgcactactttgactacttgaaggaaaatagtaaaaattta
gttggagccctacagttcgtcttccaacttagttttttgtgtccgacaaagagctatcca
gtagaggcactgagtactgcccaacaggaagtattacaacatatgcgcgaactcggttta
gcttatcaacgaaaacgtacagcgcctcgtttctatgtaactcctcttgctttggatttc
gctggaggtcatactactttcttggaaagtaaatcaggtggatggggtccacaatcgggg
gttattcctactggtgtctcaaaatcagatcccaccgacagcaataaaatgttttcgcag
atttcagtatcgaattcttccgatgttggttacattttgctcgaaaccaattttcgacta
tacgcctatacagattcaccgcttcgtactgctcttcttagcttatttagcaaaatacgt
gcacgttttcctaatcttgttgttgctgatataacccgtgactcagttcgggaagcatta
attcgtggaataactgcaaatcagatcctatctttcttaacagccaatgcacatccagat
atgttactacagaatcctatattaccgcctactttaaccgatcaaatacgactatgggaa
ttagagcgagatagatttctatttcaagaaggctgtctgtatgaacaattctctcggaat
acagattttgaaatggttcgggattatgctaaaagtattggtgttttactctgggaaaat
cctgaacgaagacttatggttgtgtctaaagcaggtcatgaagatgtacggaaattttgg
aaacacaaacgtccgtcctaa

DBGET integrated database retrieval system