KEGG   Schistosoma mansoni: Smp_084830Help
Entry
Smp_084830        CDS       T01095                                 

Definition
(RefSeq) UDP-glucose 6-dehydrogenase
  KO
K00012  
UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
smm  Schistosoma mansoni
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Smp_084830
   00053 Ascorbate and aldarate metabolism
    Smp_084830
   00520 Amino sugar and nucleotide sugar metabolism
    Smp_084830
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     Smp_084830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
AA seq 486 aa AA seqDB search
MLSKVCCLGAGYVGGSTLSIIAHYCPEIQVTVVDTCDEQIKMWNSDTLPIYEPGLDEIVK
LHRGKNLHFSSDIDKAIDDAEMIFISVNTPTKNWGLGKGRATDLTNLEAAARRIAKVSRQ
PKVIVEKSTVPVKAAETTSTILQFEAKSRRSLSNLTITTNNNKLNEFVVLSNPEFLAEGT
AVNDLCNPDRILIGGDSHSLSGKLAIEMLRWIYLHWVPAERILITSTWSSELSKLAANAF
LAQRISSINAISAICEQTNADIKEVSKAIGTDHRIGPHFLNASLGFGGSCFRKDILSLMY
ISETLNLPEVASYWYSVLQMNNYQIDRFTRNVIEKLHNTLKGKRIAIFGFTFKADTYDSR
DSPVIPLCNQLLQEQAELAIYDPKAHHKQIESDLLMNNNKDSLSQFVHICSTPEEAVTNA
YAILICTDWKCFQDYDYAKFYRLMTKPARIFDGRIILNHKELSQIGFIVEAIGIASESFT
MNGYVD
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcaaaagtgtgctgtcttggtgcaggttatgttggaggttcaacactttcaatt
atagctcattactgtccggagattcaagttactgttgttgatacttgtgatgaacaaatc
aagatgtggaactcagatacgctaccaatatatgagcccggattggatgagattgttaaa
ttacaccgtggaaaaaatttacacttttcttcggatattgacaaagccatagatgatgct
gaaatgatttttatctcagtgaataccccaacaaaaaattggggcctcggtaagggtaga
gcaactgatctgactaacttggaggctgcagctcgacgtatagctaaagtatcacgacaa
ccgaaagttatagttgaaaaaagtacagtaccggtgaaagcagcagagactacaagtaca
atacttcaatttgaagctaagtctcgtcgtagcctatccaatcttacaataacaactaat
aataataagcttaatgaattcgtagtcttatcgaacccggaatttttagctgaaggtact
gctgtcaatgatttatgtaatccagatcgtattttaattggtggtgattcacattcatta
tctggtaaattagcaattgaaatgttacgttggatatatttacattgggtaccagccgaa
cgtatacttattacatcgacgtggtcatcagaattatctaaattggcagctaatgctttt
cttgctcaacgtattagcagtatcaatgctatctcggctatatgtgaacaaacaaatgct
gatattaaagaagtgtctaaagcaatcggtacagatcatcgaattggtccgcatttttta
aatgctagtcttggctttggtggtagttgttttcgtaaagatattttaagtttgatgtat
atatcagagacattgaatttaccagaagtagcttcttattggtatagtgtactacaaatg
aataattatcaaattgatagatttacacgtaatgtaattgaaaaattacataatacatta
aaaggaaaacgtattgcaatatttggcttcacttttaaagcagatacatatgattcaaga
gatagtcctgtgataccattgtgtaatcaattattacaagaacaagctgaactagcaatc
tatgatcctaaagctcatcataaacaaattgaatcagacttgttaatgaataataataaa
gattctttaagtcaattcgttcatatttgttctacacctgaagaagctgtcaccaacgcc
tatgctattctaatatgtacagattggaaatgtttccaagattatgattatgcgaaattt
taccgtttaatgacaaaaccagcaagaatatttgatggacgcattatattgaatcataaa
gaattaagccaaataggttttattgttgaagcaatcggtattgcatcagagagttttacc
atgaatggttatgttgactaa

DBGET integrated database retrieval system