KEGG   Schistosoma mansoni: Smp_084830Help
Entry
Smp_084830        CDS       T01095                                 

Definition
UDP-glucose 6-dehydrogenase
Orthology
K00012  
UDPglucose 6-dehydrogenase [EC:1.1.1.22]
Organism
smm  Schistosoma mansoni
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Smp_084830
   00053 Ascorbate and aldarate metabolism
    Smp_084830
   00500 Starch and sucrose metabolism
    Smp_084830
   00520 Amino sugar and nucleotide sugar metabolism
    Smp_084830
Enzymes [BR:smm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.22  UDP-glucose 6-dehydrogenase
     Smp_084830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 486 aa AA seqDB search
MLSKVCCLGAGYVGGSTLSIIAHYCPEIQVTVVDTCDEQIKMWNSDTLPIYEPGLDEIVK
LHRGKNLHFSSDIDKAIDDAEMIFISVNTPTKNWGLGKGRATDLTNLEAAARRIAKVSRQ
PKVIVEKSTVPVKAAETTSTILQFEAKSRRSLSNLTITTNNNKLNEFVVLSNPEFLAEGT
AVNDLCNPDRILIGGDSHSLSGKLAIEMLRWIYLHWVPAERILITSTWSSELSKLAANAF
LAQRISSINAISAICEQTNADIKEVSKAIGTDHRIGPHFLNASLGFGGSCFRKDILSLMY
ISETLNLPEVASYWYSVLQMNNYQIDRFTRNVIEKLHNTLKGKRIAIFGFTFKADTYDSR
DSPVIPLCNQLLQEQAELAIYDPKAHHKQIESDLLMNNNKDSLSQFVHICSTPEEAVTNA
YAILICTDWKCFQDYDYAKFYRLMTKPARIFDGRIILNHKELSQIGFIVEAIGIASESFT
MNGYVD
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcaaaagtgtgctgtcttggtgcaggttatgttggaggttcaacactttcaatt
atagctcattactgtccggagattcaagttactgttgttgatacttgtgatgaacaaatc
aagatgtggaactcagatacgctaccaatatatgagcccggattggatgagattgttaaa
ttacaccgtggaaaaaatttacacttttcttcggatattgacaaagccatagatgatgct
gaaatgatttttatctcagtgaataccccaacaaaaaattggggcctcggtaagggtaga
gcaactgatctgactaacttggaggctgcagctcgacgtatagctaaagtatcacgacaa
ccgaaagttatagttgaaaaaagtacagtaccggtgaaagcagcagagactacaagtaca
atacttcaatttgaagctaagtctcgtcgtagcctatccaatcttacaataacaactaat
aataataagcttaatgaattcgtagtcttatcgaacccggaatttttagctgaaggtact
gctgtcaatgatttatgtaatccagatcgtattttaattggtggtgattcacattcatta
tctggtaaattagcaattgaaatgttacgttggatatatttacattgggtaccagccgaa
cgtatacttattacatcgacgtggtcatcagaattatctaaattggcagctaatgctttt
cttgctcaacgtattagcagtatcaatgctatctcggctatatgtgaacaaacaaatgct
gatattaaagaagtgtctaaagcaatcggtacagatcatcgaattggtccgcatttttta
aatgctagtcttggctttggtggtagttgttttcgtaaagatattttaagtttgatgtat
atatcagagacattgaatttaccagaagtagcttcttattggtatagtgtactacaaatg
aataattatcaaattgatagatttacacgtaatgtaattgaaaaattacataatacatta
aaaggaaaacgtattgcaatatttggcttcacttttaaagcagatacatatgattcaaga
gatagtcctgtgataccattgtgtaatcaattattacaagaacaagctgaactagcaatc
tatgatcctaaagctcatcataaacaaattgaatcagacttgttaatgaataataataaa
gattctttaagtcaattcgttcatatttgttctacacctgaagaagctgtcaccaacgcc
tatgctattctaatatgtacagattggaaatgtttccaagattatgattatgcgaaattt
taccgtttaatgacaaaaccagcaagaatatttgatggacgcattatattgaatcataaa
gaattaagccaaataggttttattgttgaagcaatcggtattgcatcagagagttttacc
atgaatggttatgttgactaa

DBGET integrated database retrieval system