KEGG   Schistosoma mansoni: Smp_085500Help
Entry
Smp_085500        CDS       T01095                                 

Definition
histone acetyltransferase-related
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Smp_085500
Transfer RNA biogenesis [BR:smm03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Smp_085500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 563 aa AA seqDB search
MAKARKIPNATKEELMVLTVSEIISHLLKAIEEKRDVDLNKLKSVISSKYGLASQPRLVD
LIAAVPTEHRHVLLPHLKAKPVRSASGIVVIAVMCKPHRCPHIAVTGNVCVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYNPFIQTRHRIEQLQQLGHTCDKVEFIVMGGTFMCLSE
DYRDYFIRSLHDALSGHTSQNVDEAVSYSERSKTKCVGITIETRPDYCLKKHLSEMLRYG
CTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLSKDAGFKVVSHMMPDLPNVGWERDLA
QFAEYFENPAFRSDGLKIYPTLVIRGTGLYELWRTGRYKSYPPGMLIDLIARILALVPPW
TRIYRIQRDIPMPLVTSGVEHGNLRELVLARMEELGASCRDVRTREVGIQEIHSRVKPYQ
VELVRRDYVANGGWETFLAYEDPYQDILIGLLRLRKCSLQTFRPELIVKTHNNDDDDVQG
NKDPRCSIVRELHVYGSAVPVAARDPTKFQHQGFGTLLMEEAERIAKYEHGSLKIAVISG
VGTRNYYRKLGYKLEGPYMIKFL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagctcgtaaaatacccaatgccaccaaagaggaactcatggttttaaccgtg
agtgaaataatctcacaccttttaaaggctatcgaggaaaaacgtgatgttgatttaaat
aaactgaaatcagtgatatctagtaaatatggtttagcctcacaaccacgactggttgat
ttaatcgcagctgtaccaacagaacatagacatgtgctgttgccacatttgaaagcgaaa
ccagtgagatcagctagtgggattgtagttatagcagttatgtgtaaacctcaccgatgt
cctcatatagctgtgaccgggaatgtttgcgtctattgtccaggtggaccagattctgat
tttgaatactccacacagtcgtatactggatatgagcccacttcaatgcgtgctattcga
gctcgttacaatccttttattcaaacacggcatcgaattgaacaacttcaacaactggga
catacatgtgataaagttgaatttattgttatggggggaacgtttatgtgtctttctgaa
gactatcgggattatttcattagaagtttacatgatgcactatctggtcatacaagccaa
aacgttgacgaagctgttagttattctgaacgaagtaaaacaaaatgtgttggaatcacc
attgaaacacgtccagattattgtttaaaaaaacatttaagtgaaatgttacgttatggt
tgtacacggttagagattggtgttcaaagtgtctatgaagatgttgccagagatacaaat
agaggtcatactgttaaagctgtttgtgaatcatttcatttatctaaagatgctggattt
aaagttgtttcacatatgatgcctgatctaccaaatgttggctgggaacgtgatttagca
caatttgctgaatattttgaaaatccagcatttcgttcagatggattaaaaatttatcca
acacttgttatacgtggtacaggtttatatgaattatggcgtactggtcgttataaaagt
tatccacctggtatgctaattgatttgattgctagaatattagctttggttccaccatgg
actcgaatttatcgtattcaaagagatattcctatgccattggtaactagtggtgtggaa
catggtaatttacgtgaacttgtattagctcgaatggaagaactaggtgctagctgtcgt
gatgttcgaacacgtgaagttggcatacaagaaatacattcacgtgtaaaaccatatcag
gttgaacttgttcgtagagattatgttgcaaatggtggttgggagacatttttagcctat
gaggatccatatcaagatatattgatcggtttattacgtttaagaaagtgttcactgcaa
acatttagaccagaattaatcgttaaaacacataataatgatgatgacgatgttcaaggt
aataaagatcctcgttgttccattgtgcgtgaattacatgtatatggtagtgctgttcca
gtggctgctagggatcccacgaagtttcaacatcaaggtttcggaactttactaatggaa
gaagcagaacgtatagctaaatatgaacatggttcattgaagattgcagttatatccggt
gtggggactagaaactactatcgaaaattgggttataaattagagggtccatatatgatc
aagtttctataa

DBGET integrated database retrieval system