KEGG   Schistosoma mansoni: Smp_086690Help
Entry
Smp_086690        CDS       T01095                                 

Definition
kinase
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
smm  Schistosoma mansoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 384 aa AA seqDB search
MSCRPQLIGRSPLGQLKSYGLLTSGCKYHSCQGKLTIPNVCQDLEFSTEDLVDEGEIGRG
AYGFVNRMMHRPTKTVMAVKRIRSTLNEREQRNTLKDLDVVMNSANCPNIVLFYGAIFTE
GDCWICMEMMSTSLDKFYKFVYNYLQSRIPESVIGKITTATVSALDYLKTALKVIHRDVK
PSNILIDCDGNVKLCDFGISGQLVDSIARSRDAGCKPYMAPERIHPELSANGYDIRSDVW
SLGITLIELSTGQFPYPAWNSVFEQLTCVLHNDPPSLPEYLPKSIQTSSSTTTLVNIEYS
NHSISNNSNESCSSTTDFSSEFRDFVSQCLEKDVRCRPKYQALMHHPFYLRSLTEVIDVG
KYFQSILDKVPPHINMNELSQTNS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtcgacctcaactaattggcagatctcctttgggacagttgaagtcctatgga
ttattaacatcgggatgtaaatatcattcatgtcaaggaaaattaaccattccaaatgtt
tgtcaagatttggaattctcaactgaggatcttgtggatgaaggagaaattggtcgaggg
gcatatggatttgttaatcgtatgatgcatagacctacgaaaacagttatggcagttaag
cgaatacgttcaacattaaatgaacgtgaacaaagaaatacattaaaagatttagatgtt
gttatgaattcagcaaattgtccaaatattgttttattttatggtgcaatatttacagaa
ggtgattgttggatatgcatggaaatgatgtctacttcattagataaattttataaattt
gtttataattatttacaatcaagaatacctgaaagtgttattgggaaaattactacagct
actgtttcagctctcgattacttgaaaactgctcttaaagtcatacaccgagatgtaaaa
ccatcaaatattctaatcgattgtgacggtaatgtgaaattatgtgactttggtatatct
ggtcagttggtcgatagtattgctcgatcacgtgatgctggttgtaaaccgtatatggcg
ccagaacgtattcatccagagttaagcgctaatggctatgatatacgctcagatgtatgg
agtttaggtattaccttgattgaattatctactggacaatttccttatccagcatggaat
tccgtatttgaacaactcacttgtgtattacataatgatccacctagtttaccggaatac
ttaccaaaatctattcaaacttcatcatcaactacaacccttgtcaatattgaatattcc
aatcattctataagtaataattcaaatgaatcttgttcatcaacaacagatttttcatct
gaatttcgtgattttgtctcacagtgcttagagaaagatgtgagatgtcgaccgaaatat
caagcacttatgcatcatccattttatttacgctcactaactgaagttattgatgttgga
aaatattttcaatcgatattagataaagttcctcctcatataaatatgaatgaattaagt
cagactaacagttga

DBGET integrated database retrieval system