KEGG   Schistosoma mansoni: Smp_089290Help
Entry
Smp_089290        CDS       T01095                                 

Definition
alpha-galactosidase/alpha-n-acetylgalactosaminidase
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
smm  Schistosoma mansoni
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smm00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smm00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smm00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:smm00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:smm04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 444 aa AA seqDB search
MLVTMFQQQAHRCAILTIVLTAIILTASCVLCLDNGMATVPPMGWMTWQRFRCQTDCQNY
PDGCISEKLIKRTADRLVLDGWRDLGYRYVIVDDCWPEWKRDSRTNEIVADNKRFPNGIK
SVGQYLHSKNLRFGIYLDYGTRTCEGYPGSMNYLELDAKSVAKWEADYVKMDGCNSPENI
MPDGYGKFSKLLNATGRPIVFSCSYPAYISWMKNTSLIDWKKLQNNCNLWRMLGDVQDSW
SSVISIINAYKLQNAVLPKLAGPGHWNDPDMLLMGNFGLSDDQKRVQMGMWCMFSAPLLI
SADMDKLDNFSVSLLRNARLLAIDQDKGGHQAEFVKSQNDVQMWVRPLDGDPIGWAIACL
FTTDGGGPIHFYTSLDEFKSQSYRISGDKFELVDVFSGDRFQVVQRTQKFMISINPSGIM
MYRVRRVQQKTVSEEIDGLFQTLL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttacgatgttccagcaacaagcccataggtgtgccatattaacgatagttttg
acagcgattattctcactgcctcatgcgttttgtgtttggataatggaatggctaccgta
ccaccgatgggttggatgacatggcaacgatttcgatgtcaaactgattgtcagaactac
ccagatggttgtatcagtgagaaattgatcaaacgcacagctgacagactagtattagat
ggttggagagatttaggttatcgttatgtaatagtagatgattgttggccagaatggaaa
cgagattctaggactaatgaaatcgttgcagataataaacgatttcctaacggtattaaa
agtgttggacaatatttacattctaaaaatctacgatttggcatatatctcgattatgga
acacgaacatgtgaaggttatccaggaagtatgaattatttggaattggatgctaaaagt
gtggctaaatgggaagctgattatgtaaaaatggatggatgcaatagtccagaaaacatt
atgccagatggttatggaaaattctctaaattattgaatgcaactggtagaccaatagtg
ttctcatgcagttatcctgcttacatttcttggatgaaaaatactagtttaattgactgg
aagaaattgcagaacaattgtaatctatggcgtatgctgggcgacgttcaagatagttgg
tcatcggttatcagtattataaacgcatataaactccaaaatgctgtgttaccgaaattg
gctggtccaggacactggaatgatcctgatatgttgttaatgggaaactttggtctttca
gatgatcagaaacgagtgcaaatgggtatgtggtgtatgttttctgctccactactgatc
tcagctgacatggacaagttggataatttcagtgtatctttattacgtaatgcacgttta
ttggcgatagatcaagataaaggtggacatcaggcggaattcgtcaaatcacaaaatgat
gtacagatgtgggtgagaccgttagatggagatccaattggttgggcaatcgcttgtctt
ttcacgactgatggtggtggaccgattcacttttacacaagtcttgatgaattcaaatca
caatcgtataggatatctggtgataagtttgaattggtggatgtgttcagtggggacaga
ttccaagtggttcaacgaacacagaaatttatgatttctatcaatccaagcgggataatg
atgtatcgagttagacgtgttcaacagaagactgtttctgaagaaattgatggactgttt
cagacattgttatag

DBGET integrated database retrieval system