KEGG   Schistosoma mansoni: Smp_089290Help
Entry
Smp_089290        CDS       T01095                                 

Definition
(RefSeq) putative alpha-galactosidase/alpha-n-acetylgalactosamini da se
  KO
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
smm  Schistosoma mansoni
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo and isoglobo series
Lysosome
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Smp_089290
  Lipid metabolism
   00561 Glycerolipid metabolism
    Smp_089290
   00600 Sphingolipid metabolism
    Smp_089290
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Smp_089290
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Smp_089290
Enzymes [BR:smm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Smp_089290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
6
AA seq 408 aa AA seqDB search
MATVPPMGWMTWQRFRCQTDCQNYPDGCISEKLIKRTADRLVLDGWRDLGYRYVIVDDCW
PEWKRDSRTNEIVADNKRFPNGIKSVGQYLHSKNLRFGIYLDYGTRTCEGYPGSMNYLEL
DAKSVAKWEADYVKMDGCNSPENIMPDGYGKFSKLLNATGRPIVFSCSYPAYISWMKNTS
LIDWKKLQNNCNLWRMLGDVQDSWSSVISIINAYKLQNAVLPKLAGPGHWNDPDMLLMGN
FGLSDDQKRVQMGMWCMFSAPLLISADMDKLDNFSVSLLRNARLLAIDQDKGGHQAEFVK
SQNDVQMWVRPLDGDPIGWAIACLFTTDGGGPIHFYTSLDEFKSQSYRISGDKFELVDVF
SGDRFQVVQRTQKFMISINPSGIMMYRVRRVQQKTVSEEIDGLFQTLL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgtaccaccgatgggttggatgacatggcaacgatttcgatgtcaaactgat
tgtcagaactacccagatggttgtatcagtgagaaattgatcaaacgcacagctgacaga
ctagtattagatggttggagagatttaggttatcgttatgtaatagtagatgattgttgg
ccagaatggaaacgagattctaggactaatgaaatcgttgcagataataaacgatttcct
aacggtattaaaagtgttggacaatatttacattctaaaaatctacgatttggcatatat
ctcgattatggaacacgaacatgtgaaggttatccaggaagtatgaattatttggaattg
gatgctaaaagtgtggctaaatgggaagctgattatgtaaaaatggatggatgcaatagt
ccagaaaacattatgccagatggttatggaaaattctctaaattattgaatgcaactggt
agaccaatagtgttctcatgcagttatcctgcttacatttcttggatgaaaaatactagt
ttaattgactggaagaaattgcagaacaattgtaatctatggcgtatgctgggcgacgtt
caagatagttggtcatcggttatcagtattataaacgcatataaactccaaaatgctgtg
ttaccgaaattggctggtccaggacactggaatgatcctgatatgttgttaatgggaaac
tttggtctttcagatgatcagaaacgagtgcaaatgggtatgtggtgtatgttttctgct
ccactactgatctcagctgacatggacaagttggataatttcagtgtatctttattacgt
aatgcacgtttattggcgatagatcaagataaaggtggacatcaggcggaattcgtcaaa
tcacaaaatgatgtacagatgtgggtgagaccgttagatggagatccaattggttgggca
atcgcttgtcttttcacgactgatggtggtggaccgattcacttttacacaagtcttgat
gaattcaaatcacaatcgtataggatatctggtgataagtttgaattggtggatgtgttc
agtggggacagattccaagtggttcaacgaacacagaaatttatgatttctatcaatcca
agcgggataatgatgtatcgagttagacgtgttcaacagaagactgtttctgaagaaatt
gatggactgtttcagacattgttatag

DBGET integrated database retrieval system