KEGG   Schistosoma mansoni: Smp_093280Help
Entry
Smp_093280        CDS       T01095                                 

Gene name
SmHDAC3
Definition
histone deacetylase
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Smp_093280 (SmHDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 418 aa AA seqDB search
MGKDKRVVYFYDPDCGNFHYGPNHPMKPHRLTLTHTLVVNYNLTDRMKVYKPYHASMKDM
ISFHSQEYIEFLRDVTPTNVHTFPKEKLLTYNIGEDCPIFDGIYRFSSIHTGASLQAAKY
LNNGVTDIAINWSGGLHHAKKFEASGFCYVNDIVIATLELLKYNPRVLYIDIDVHHGDGV
QEAFYLTDRVMTVSFHRYGNMFFPGTGDMYEIGAKAGKYYAVNVPLKEGIDDDMYFSVFR
AVINDVVAFYRPTTIVLQCGADSLGCDRLGVFNLSIRGHGRCVRMVKELGLPLLVVGGGG
YTVRNVARCWAYETAVLLDQEKEISNELPYSPYIEFFYPDYTLHPDLTTKLDNANTRQYI
EALRMTVHDNLKQLVHAPSVQFTDVPNDYLSNFCNDSNDEREKPNEMFVEEEQDSTAA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagacaagcgtgttgtatatttttacgatccagattgtgggaattttcattat
ggaccgaatcatcccatgaaaccacatagacttacactaactcatacccttgtggtaaat
tataatctgacagatcgtatgaaggtctacaaaccatatcatgctagtatgaaggatatg
atatcatttcattcacaagaatatatcgaattcttgcgtgatgttacaccaactaatgtg
catacatttcctaaagaaaaattattaacctataatattggtgaagattgtccaattttc
gatggtatatatcgcttttcctctattcacactggtgcatcacttcaagctgctaaatat
ttaaataatggagtaacagatattgcaatcaattggtcaggcggacttcatcatgctaag
aaatttgaagcgtctggattttgttatgtaaatgatattgtaatagccacattagaatta
ttgaaatataatccacgtgtactttatatcgatattgatgttcatcatggtgatggcgta
caagaagcattttacctcacggatcgtgtaatgacagtatcatttcatcgttatggaaac
atgtttttccctggaacaggtgatatgtacgaaattggagccaaagctgggaaatactac
gcagtgaatgttcctttaaaagaaggcattgatgacgatatgtatttcagtgttttccga
gccgttataaatgacgtagttgcattttatcgaccaacaactattgtacttcaatgtggc
gctgattcgcttggctgtgatcgattaggtgtattcaatctgtccattagaggtcacggg
agatgtgttcgaatggttaaagaacttggtctaccattattggttgttggcggtggcggt
tatactgtacggaatgtagcacgctgttgggcatatgaaacagctgtactacttgatcaa
gagaaagaaatttccaatgaattaccttattccccgtacattgaattcttttatcctgat
tatacattacatccagacttgacaactaagttggataatgcgaacacacggcaatatatt
gaagcgctacgaatgacagttcatgataatttaaaacaacttgtacatgctccaagtgtt
caatttactgatgtaccgaatgattatctatcgaacttttgtaatgattcgaatgatgaa
cgggaaaaaccaaacgaaatgtttgttgaagaagagcaagactcaacagctgcttga

DBGET integrated database retrieval system