KEGG   Schistosoma mansoni: Smp_094880Help
Entry
Smp_094880        CDS       T01095                                 

Definition
starch branching enzyme II
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smm  Schistosoma mansoni
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Smp_094880
Enzymes [BR:smm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Smp_094880
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smp_094880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 684 aa AA seqDB search
MFYTPEEIEAVNVPNIQNLLQLDPWLEPYKHEIKRRYKCFLDHMKWINDVCGLEEFTQGY
KEFGVHVRDDGSIYCKEWAPGAKEMYLRGDFNDWQEFTHPFKNVGFGKWELTIPSANGSP
VINHLSKIKLLVVAQDGRRLDRLSPWAPYVKCFGGNIIYDQLLYNPPERYQLKYPHPPRP
KSLRIYECHIGISSSEPVVASYSHFKDNILPRIKDLGYNAIQIMALMEHAYYASFGYQVT
SFFAASSRFGTPEELRAMVDEAHRLGIVVLLDVVHSHASKNTNDGLNQFDGTNACYFHDL
GRGTHELWDSRLFNYTELEVLRFLMSNLRWWIEEYGFDGFRFDGVMSMLYHHHGLMTNFS
GHYGEYFGLSVDTESFTYLMLANHFLHEKYPFIITIAEEVSGMPTLCRPVSEGGGGFDYR
LAMAIPDKWIELLKKYKDEDWNMGNLVHTLTNRRYGEPNIAYTECHDQALVGDKTLSFWL
MDKEMYFSMSTLSPPNLIIDRGIALHKLIRFITHTLGGEGYLNFMGNEFGHPEWLDFPRA
GNNSSYHYARRQWNLVDDPLLRYKYLNNFDRAMQHLEERYGWLAAPQAYVSRKNEGDKVI
AFERAGVLFVFNFHPTQSFTDYKIGVETPGQYHIVLDSDQEEFGGFKRIDQSVDVFTRNE
PWDNRRNCVFLYLPSRTCMALALQ
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgttttacacaccggaagaaatcgaggctgtcaatgtaccaaatatacagaatctgcta
cagctagatccctggttagaaccttataaacatgagatcaaacgccgatataaatgcttt
ttagatcatatgaagtggataaacgatgtgtgtggtttagaagagtttactcagggctac
aaggaatttggggttcatgtacgtgatgatggatcaatatactgtaaagaatgggctcca
ggagcgaaagaaatgtacttgaggggagattttaatgattggcaggaatttactcatcct
ttcaagaatgtgggttttgggaaatgggagttaacaataccatctgctaatggttcacct
gtgataaatcatctttcgaaaatcaaacttttagtggtcgctcaagatggtcgtcgactg
gatagattgagtccatgggctccatatgttaaatgctttggggggaatatcatttatgac
caattattgtacaatcctcctgagagataccaacttaaatatccacatcctccacggcct
aaaagccttcgaatttacgagtgtcacattggtatttcgtcatctgaaccagttgtcgca
tcttattctcatttcaaggacaatattcttccccgaattaaagacctaggttataacgca
attcagataatggcgctaatggaacatgcttactatgcttcgttcggataccaggtgact
agcttctttgctgcctccagtcgctttggcactccagaggagctacgcgccatggttgat
gaagcacaccgactgggcattgtagttctcctagatgttgttcatagtcatgcctctaag
aatacaaatgatggtctcaaccagttcgatggcacaaatgcttgttatttccatgatcta
ggccgtggaactcatgaattatgggattctcgtctattcaattatacagagttggaagtg
ttacgcttccttatgtcaaatttacgttggtggattgaagagtacggttttgatggtttc
cgtttcgatggggttatgtctatgttgtatcatcatcatggtttgatgaccaacttttcc
ggtcattatggggaatattttggtctgtccgtagacacagaatcatttacttatttaatg
ttagctaaccattttctacacgaaaagtatccatttattattacgattgcagaagaggtt
agcggcatgcctactctgtgtcgtccagtttccgaaggcggcggtggattcgactatcga
ttagctatggccattcctgataaatggattgagcttctaaagaaatataaagatgaagat
tggaacatgggtaatctcgtccatacattgactaatcgacgttatggtgaaccaaatatt
gcatacacagaatgtcatgatcaagctttggttggtgataagacattatccttttggctt
atggacaaagaaatgtacttcagtatgagcactttaagccctccaaatttaattattgac
cgtggtattgcattacacaagttaatacgttttataacacacaccttaggtggtgaaggt
tatctcaactttatgggtaatgagtttggtcatcctgaatggttggatttcccaagagct
gggaataatagttcctatcactatgctcgccgtcagtggaacttggtggatgatccatta
ttgcgttataaatatctaaacaactttgacagagctatgcaacatttagaggaaagatac
ggttggcttgcagctccacaggcctatgttagtagaaagaatgaaggcgataaagttatt
gcgtttgaacgtgctggagttttgtttgtctttaattttcatcccactcaaagttttacg
gattacaaaattggagtcgaaacacctggacagtatcatattgttttggattctgaccaa
gaagaatttggtggctttaaacgaatcgaccaatctgttgatgttttcaccagaaatgaa
ccatgggataatcgtcgaaattgtgtttttctatatctgccaagccgtacctgtatggct
ttagcactgcaataa

DBGET integrated database retrieval system