KEGG   Schistosoma mansoni: Smp_096760Help
Entry
Smp_096760        CDS       T01095                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smm  Schistosoma mansoni
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smp_096760
   01230 Biosynthesis of amino acids
    Smp_096760
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smp_096760
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smp_096760
Enzymes [BR:smm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Smp_096760
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Smp_096760
  Exosomal proteins of melanoma cells
   Smp_096760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 250 aa AA seqDB search
MAPYRIVFIRHGESVYNEENRFCGWHDADLSGQGITEAKQAGQLLRQNHFTFDIAYTSVL
KRAIKTLNFVLDELDLNWIPVTKTWRLNERMYGALQGLNKSETAAKHGEEQVKIWRRAYD
IPPPPVDISDPRFPGNEPKYALLDSSCIPRTECLKDTVQRVLPFWFDTISASIKRREQVL
IVAHGNSLRALIKYLDNTSDSDIVELNIPTGIPLVYELDANLKPTKHYYLADEATVAAAI
ARVANQGKKK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctccttacagaattgtgtttattcgccatggagagagtgtttacaatgaagaaaat
cgattttgtggttggcatgatgcagatctttcaggacaaggtatcactgaggctaaacaa
gctggccaacttctacgccaaaatcacttcacctttgatattgcctatacaagcgttcta
aaaagagccatcaagactttaaactttgtccttgatgaacttgatcttaactggatacct
gtgacaaaaacatggcgtctaaatgaaagaatgtacggtgctcttcaaggtctgaataag
tctgaaactgctgccaaacatggagaggaacaagttaaaatatggagacgtgcttatgat
atacctccccctcctgttgacatttcagatcctcgcttccccggtaatgaaccaaagtat
gccttacttgactcttcctgcataccacgtactgagtgtttaaaggacactgttcaacgt
gtactgccattttggtttgatactatttctgcaagtataaagagacgcgaacaggttctg
attgtcgcccatggaaacagtttaagagcgcttatcaagtacttggataatacatctgat
tcagatattgtggaactcaatatacccactggtattccactagtctatgaactggatgcg
aacttgaagccaaccaaacactattatcttgccgatgaagcgacagtagcagcagcaata
gcacgtgtggcgaaccagggaaaaaagaaatga

DBGET integrated database retrieval system