KEGG   Schistosoma mansoni: Smp_104330Help
Entry
Smp_104330        CDS       T01095                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smm  Schistosoma mansoni
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:smm01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:smm00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:smm00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 424 aa AA seqDB search
MRLPPFLSHVFVKRCVNISSPCRTCTVLKSNYTSDHGSYFASRISLRQLHFNPCIFAIRV
VNVPPFAESVTEGDIVWKKAVGDTVNVDDVIAEIETDKTNVPVPAPCSGVITQLLVEDGG
KVTAGQDIFKIEEGAVPTSTVSEKPSQETVKKQPEEKLLVSPRPPSPVTHSPPPEIAQSL
ATPSLSPSLDSARAEQRVKMSRMRLRIAQRLKDAQNTCAMLSTFNEIDMSNLFELRSQYK
DTFLKNHGVKLGMMSTFAKASAVALMDQPAVNAVIDGSDIIYRDYVDISIAVATPKGLVV
PVLRNVEKMNYADIERGISDLGVKARDGKLAVEDMDGGTFTISNGGVFGSLFGTPIINPP
QSAILGLYGVFDRPVARNGQVVIRPMMYVALTYDHRLIDGREAVTFLRKIKEFVEDPRTY
FLQI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagattaccaccgttcctttcgcatgtttttgtcaagcgttgtgtgaatatcagttct
ccttgtcgtacatgtacagttttaaaatcgaattatacttcagaccatggttcatatttc
gcctctaggatatctctacgacaactgcacttcaacccctgtatttttgccatacgtgta
gttaatgtacctccgttcgctgaatctgtcacagaaggggatatcgtgtggaaaaaagcc
gtcggtgatacagtaaatgtagacgatgtgattgcggagatcgaaactgacaaaactaat
gtccctgtcccagccccatgttcaggtgtgataacacaacttcttgttgaagatggagga
aaagttactgcaggtcaagacatatttaaaatagaggagggtgccgttccaacttccacg
gtctctgaaaagccatcccaagagactgtaaaaaaacagcctgaagagaaacttctcgtc
tcacctcggcctccttcaccagttactcactctccacctccagaaatagctcaaagtctt
gcaacaccatccttatccccatctcttgatagtgcacgtgcagaacagcgtgtaaagatg
agtcgtatgaggctgcggatcgcccaacgtctaaaagatgcccagaatacgtgtgcgatg
ttaagcacctttaatgagattgatatgtcaaatcttttcgaacttagaagtcagtataaa
gataccttcttgaaaaatcatggtgtgaagttaggaatgatgtccacgtttgctaaagct
tctgcagtcgctctcatggatcaaccagccgtcaatgctgttattgatggctcggacatt
atttacagagattatgttgatattagtattgcagtcgcaacccctaagggtcttgtcgtt
cctgtattacgcaatgttgagaaaatgaattatgctgatattgaacgtggtatcagtgat
ttaggtgtgaaggcccgtgacggaaaactggctgttgaagatatggatggagggactttt
acgattagcaacggtggtgtttttggctcattatttggtactcctataatcaatccaccc
caatctgcaatcttaggtttgtatggagtatttgatcgaccggttgcacgaaacggacaa
gttgtcattcgtccaatgatgtatgttgccctaacttatgatcatcgtttgatcgacggt
cgtgaagcagtaacgtttttacgtaaaatcaaggaatttgttgaggatccacgaacatac
ttccttcagatttaa

DBGET integrated database retrieval system