KEGG   Schistosoma mansoni: Smp_105910Help
Entry
Smp_105910        CDS       T01095                                 

Definition
CREB-binding protein 1 (SmCBP1)
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
smm  Schistosoma mansoni
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Smp_105910
   04330 Notch signaling pathway
    Smp_105910
   04350 TGF-beta signaling pathway
    Smp_105910
   04630 Jak-STAT signaling pathway
    Smp_105910
   04068 FoxO signaling pathway
    Smp_105910
Enzymes [BR:smm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Smp_105910
Transcription factors [BR:smm03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Smp_105910
Mitochondrial biogenesis [BR:smm03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Smp_105910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 2093 aa AA seqDB search
MAQETQQNEPRGSISLRNTQLQHPNTLAIINNYSSSGEIHTIQISSSSAKLPTATSICSL
SANNQPIQYIGPEARTLCVPVCGAHSSYSHSIVHRASPNSNVGYNPGSMTHAHCSTPASQ
PDMLETLLSRNVYNTQIHAQNHSPRVLGPSIVVTNIPSQNPSLMSSPANIRNAAPVSSTH
SIGQTYTATTSAPSVVATDPEKRQLIQQQLILLLHARRCQRQEDESNGRISQCTTPHCNT
MRGVLQHMTSCTQGKNCQTPHCASSRQIISHWKNCNNRECPVCEPLKQNQHYQRNQMIRP
PQNSTQVHPVANRVPEVNGVDSSPHSCAAQQPPGQPFRVTSIASVPVNTAVTRAPSSVIP
STQISDASNLNGVSSHVAVNCTPAEQNDWRKGVDISQRNHVVRRIVRFIFPFPDPAAYSD
PRMRNLIEYARKVEREMYVTATDIDHYFHLLAQKCYKIHRELEEKRKSRQLGVDSSVGSS
QSVVTSSSAVNSSQLNQSLSTLSNQLASPSNSVSSTLGSCTASRVPNSNITNGNYNSSNE
SYEMNSFATQDSNNSETDMSRFEHYLQNACNRHRFKSDSGTAGSSDSPIVSSSVTNLKTS
TSQPSIKSTIEDTKMVSTPAVAASGDSILVKSKVVKVEMKADETPCNDPPVNNDSFSVDT
TSNLNSSSVPLASNMLPVKPDESKWKKWSREELLRHFLQLHEEVYNDKYAEPFRAPVDPV
MLHIPDYFQVIKEPMDLTTIRNNLEDGKYTDPWQVVDHFRLMFNNAWLYNKKTSKVYKMC
TKLAELFQNRIDQVMQAMGFCCGQDYEYQPQGLYCSSSNLCTINRDATYFVYINNDKQIG
LVCDKYYQCEKCFSEAGDVIILADEPNQSIPIKREMFEKRKNNVKEKEEFVICVECGRRW
HKVCALHMNEIWPSGYICPGCLRERGIKRKENRFTAKKLPVTRLSNFLEKRVNDFLKKKE
VGTGEVTIRVLASSDKVVEVKPLMRARFTESGELSESFPYRLKAVFAFQEIDGQDVCFFG
LYVQEYGSESPQPNRRRVYVAYLDSVFFFRPKQYRTDVYHEILVGYLLYAKRCGYAMAHI
WACPPGEGDDYIFHMHPTEQKIPKAKRLQEWYRRMLQKAIIEGIVVDYKNILKDALDHQL
VSPTEIPYFEGDFWPNTLEDILKELEEEEARRRREEAMAQAEAEDDEADCSSSTNEGLPG
DPDKRSGKKKAKKRKGNKKGNTSTASKRKRLDGPIDGAEELSRKVYDTMEKLKEIFFVIR
LHRHNSAASLPPTTDPDQPVHSELMDSRDAFLQMARERHLEFSSLRRAKYSSMVLLYELH
MELRQSFMYNCNVCGAQIETRWHCNECEEYDLCSRCYKTENHPHPMVQYGLGIDEDSGTN
EETGDRPSGTGATPDRRISIEGCIRSLLHACQCRDANCRMQTCAQMKRVLCHTRNCTKKA
TNSCLLCQQLLSLLWHHARSCEESKCPVPFCSNIKYRVKQKLLQQRLQQNKLLRRRISTM
HRGALPTSESQPPTQSCPTSAIPSISSTSLNQSSINSLHQTQSPNHQSLTTNTVRNPQLS
TSSNSVEKPLSNTTPVSFQPQAQVQQQGPVLLSTGNPQYSQPPRIPVPTVASQNNQGANP
RPPVVCSSVMPSGGRVIMQPPINTGPVQRTNTPVTVSVTSGWRARPVIATASQGTVHSST
GQLIQSQAQPATATSTHSSVSILNPVNSQKPTISNKPTQVEIDHVSQVISLIKATGTSSD
EQNRRFIAWIKRHPEFHAAFFALHSQHKQQAELRAQASQRRVTTSGSMPGTSSLSTSSAI
ATSSISDASQSLLGSSGVTGNVVIVPSSVSANSNSQNTGLSRTQNINNLSTPMSSMSVVT
GSTSLGSTPTVMHQPVQWISIQSPITTNHHQPLITGCTAQPIQTVPNTTTLRFRAVPGTA
TLVQSQPQQVQHFYNTTQLGPDSAFSGNDSGSNMFVSATGPSILSVGNQQSQVLSAVPQR
LTPASSSSIGRQSSTPQAAIVHFRSQQHQPLSGTVNPMQPHIILTNTTAPASGPTHLSHQ
SQPQLVSATSNGRQVVALMTHQNIPHTNVSDPGAPLRDSGSNNSANNLGNGIQ
NT seq 6282 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagagactcagcaaaatgaacctcgtggatctattagcctacgaaatactcaa
ctgcaacatcccaacacattagcaattattaataattactcatcttctggggaaattcat
acgattcaaatatccagttcatcggctaaactgcctacagcaacatccatctgctctttg
tcagcaaataaccaacccattcaatacattggaccggaggccaggactttatgtgttcct
gtttgtggtgctcattcatcatattcccattcaattgtgcaccgtgcatcccccaattca
aatgttggatataaccctggatcaatgactcatgctcattgcagcactcctgccagccag
cctgatatgctcgagacattgctatccagaaatgtatataatacacagattcatgcacag
aatcactctccgcgtgttctcggtccatcaatagtcgtaactaacataccaagtcaaaat
ccatcactaatgagtagtcctgccaatattcgcaacgcggctcctgtttcaagcactcac
tcgataggtcagacatatacggccacaactagtgccccttcggtagttgcaacagatccg
gaaaaacgtcaactcatccagcagcagttgatcctattactccatgctcgccgttgtcag
cgccaagaagatgagagcaatggacgaataagccaatgtacaacacctcattgcaacaca
atgcgtggagtcttacaacacatgacttcatgtacacagggcaaaaattgccaaacgccg
cattgtgcttcctctcgtcaaattatatcacactggaaaaactgtaacaatcgggagtgc
cctgtgtgcgagcctttgaaacaaaaccaacactaccaacgtaatcaaatgatacgtcca
cctcaaaactcaactcaggtacatccagtcgcgaatcgcgttcccgaagtaaatggtgtt
gactccagtcctcattcctgtgctgctcagcagccgcctggccaaccttttcgagtcact
tccatcgctagtgttcctgttaacacggctgttacacgagcacctagctcagtcatccct
agtactcagatctcagacgcttcgaacctaaatggtgtcagtagtcatgtagcagtgaac
tgtactcctgccgagcaaaatgactggcgaaaaggtgtggatatatctcaacgcaatcat
gttgtccgcagaattgtacgtttcatcttcccatttcccgatcctgctgcctattcagac
ccaagaatgcgaaatctaatcgaatatgcgcgcaaagttgaacgcgaaatgtatgttacg
gctacagatattgatcattattttcatttgttggctcagaagtgttacaagatacaccgt
gagctagaagaaaaacgtaaaagtcgccagcttggagtggacagttcagtagggagttct
cagtctgtagtaacatcatcttctgctgttaactcgtcgcaattgaatcagagtttatcc
acattgtctaatcagttggcttcaccttccaattcagtttcttctacattaggttcttgc
acagcgagcagagttccgaactccaatattaccaacggtaactacaattcttcaaatgag
agctatgaaatgaattcatttgcaactcaggattcaaacaactcagaaactgacatgtca
agattcgagcattatttacaaaatgcttgcaatcgtcatcgtttcaagtcagattcagga
acagcaggatcttctgattcacctattgtgtcctcatcagttacaaatctgaaaacctcc
acgtcacagcccagtattaaatcaacaatagaagatacaaaaatggtcagcactccagct
gtagctgcctcaggagatagcatccttgttaaaagcaaagtagtaaaggttgaaatgaaa
gctgatgaaacgccatgtaacgatccaccagtgaataatgattcattttctgtggacacc
acgtcaaacctcaattcaagcagtgtcccacttgcttcaaacatgttacctgtaaaacca
gatgaaagcaagtggaagaaatggtcacgcgaagagcttttgcgccatttccttcaatta
catgaagaagtatacaatgataagtatgcagaacctttccgcgctccagttgatccagtg
atgctacatataccagattatttccaagttattaaagaacctatggaccttacgactatt
cgaaataatttggaggatggtaagtacacggacccatggcaggtcgtggatcactttcga
ctgatgtttaataatgcatggctgtacaacaaaaaaacctccaaggtttacaagatgtgc
accaagttggcagaactttttcagaatcgcatagaccaggtcatgcaagcaatggggttt
tgttgtggtcaggattatgaatatcaacctcagggtttgtattgttcctcttcaaattta
tgtacaataaaccgagatgctacttatttcgtctacatcaacaatgataaacaaatcggt
cttgtatgtgataaatattatcaatgtgaaaaatgttttagcgaagctggagatgtaatt
atattggctgacgaaccaaatcagtctatcccgattaaacgggaaatgtttgagaaacga
aagaataatgtgaaggaaaaagaagaatttgttatttgtgtggaatgtggtagacgttgg
cataaagtctgcgccttacacatgaacgaaatatggccaagtggatatatttgtcctggt
tgtttacgggagcgcggtataaagcggaaagaaaatcggttcactgctaagaagctaccc
gtaacgcgcttgagcaatttcctggagaagcgtgttaacgatttccttaagaaaaaagaa
gttggtaccggagaagttactattcgcgtgttggcaagttctgataaggttgtagaagtt
aaacctttaatgcgtgcaagattcactgaaagtggcgaattgtctgaatcatttccttat
cgactaaaggctgtttttgctttccaagaaatcgacggccaggatgtgtgtttcttcggc
ttgtacgtgcaagaatatggttcagaaagtcctcaacctaatcgtagaagggtttatgtt
gcttacctagattccgttttctttttccgaccaaaacaatataggacagatgtgtatcat
gaaattcttgttggctatctgttgtatgcaaagcgatgtggttatgcaatggcacatata
tgggcttgtccacctggtgaaggcgacgattatatttttcatatgcatcctaccgagcaa
aagattcccaaagcaaaacgattacaggagtggtaccgtcggatgcttcaaaaggctatc
atagaaggaatagtggtcgactacaaaaacatccttaaagatgctttagatcatcagctt
gtgtcacctacagagatcccttattttgaaggtgatttctggccaaatacacttgaagat
attcttaaggaactggaagaggaagaagctcgtcggcgtcgtgaagaggcaatggctcag
gcagaggctgaagatgatgaagcagattgttcaagctccaccaatgagggacttcctgga
gatcctgataagcgcagtggtaaaaagaaggctaagaaacgcaaaggtaacaagaaaggc
aatacatcaactgcaagtaaaagaaaacgcctagatgggccaatagacggtgctgaagaa
ctttcacggaaggtgtatgatactatggaaaaattaaaagaaatattttttgtgatacgc
cttcatcgacataactcggctgcctcacttccacccaccactgatccagatcaacctgta
catagtgagctaatggatagtcgagatgcgttcttacagatggcccgggaaaggcattta
gaattttcatcgttgcgtcgtgccaagtattcttctatggtcctgttgtacgaactgcat
atggaattgcgtcaaagctttatgtataactgcaatgtttgcggtgctcagatcgaaact
cggtggcattgtaatgagtgtgaagaatatgatctgtgctctcgttgttataagacagaa
aatcatccacatcctatggttcaatatggtcttggcatagatgaagattcaggcacaaat
gaagaaacaggtgatagacccagtggcactggtgctacacctgatcgtcgaatcagcata
gaaggatgcataaggtctttacttcatgcttgccagtgccgagacgcgaattgccgtatg
cagacttgtgctcagatgaaacgagttttatgccatactcgaaactgtaccaagaaagcg
acaaacagttgtttgctctgtcaacagctgttgtcactgttgtggcaccatgctcgaagt
tgtgaagagtctaagtgccctgttcccttctgttcaaacataaagtatagagttaagcaa
aagctattgcagcagcggttgcaacaaaataagttgctcagacgtcgtatttcgacaatg
caccgaggagcactgccaaccagtgaatcacaacctcctacacaaagttgtcctacctct
gcaattccatctatctcttctacttctttaaatcaaagtagcattaattcactgcatcaa
actcagtctcccaatcaccagtctttaaccacaaacacagtaagaaacccacagttatct
acttcctcaaactctgtagaaaagcctctaagtaatacgactcctgttagttttcaacca
caagctcaggtacaacaacaaggtccagtattgctttccacgggaaatcctcagtattct
cagccacctcgtatcccagtgccgactgtcgcttctcagaacaaccagggtgcaaacccg
cgtccacctgttgtatgttcttcagtaatgccttctggaggtcgtgtcataatgcagcca
ccaataaatacaggccccgtacaacgtacaaatactccagtcactgtgtccgtcacctca
ggttggcgagctcgcccagtaatagctactgcatctcaaggtacagtccattcgtctacc
ggacaactaatacaatcacaagcgcagccagctactgcaacatcaactcactcttctgtg
tctatccttaatcctgtaaacagtcaaaaaccaaccatatctaacaaacctacgcaagtt
gaaatagaccatgttagtcaagtaatcagccttattaaggctaccggaacttcaagcgat
gaacaaaaccgtcggtttatcgcatggatcaaacgccatcccgagtttcatgctgccttt
tttgctctacactcacaacataaacaacaagctgagctacgtgctcaagcaagtcaaagg
cgtgtgactacatcgggaagtatgcctggtacgtcatcactatctacgagttctgcgatt
gcaacttcctcgatatctgacgcctcccaatctcttctaggttctagtggggtcacgggt
aacgttgttatcgttccatcatctgtatctgctaattcgaattctcagaacacaggatta
agtcgaacccaaaatataaacaacctttctacacctatgtcgtccatgtctgtcgttact
ggttcaacctctttaggttccactcctactgtgatgcatcaacctgttcagtggatttct
attcagtcaccaatcactacgaatcatcaccaacctttgattactggatgtactgcacaa
ccaatccaaactgtcccaaacactacgactctgcgtttccgagcagttccaggtactgcg
acattagtgcagtcacaaccacaacaagtacagcatttctataatacgactcaacttggt
ccagattctgcgttcagtggcaatgattctggatctaacatgtttgtttcagctactggt
cccagtatattgtctgtaggaaatcagcagtcgcaagttcttagtgccgttcctcagcgc
ttaactccagcttcaagttcaagtattggtcgtcagtcctctacaccacaagcagctatt
gtgcactttagatcacagcaacaccaacccttgagtggtacagtaaatcctatgcagcct
catataatacttactaatacaaccgctcctgcaagtggcccaacccacctctcccaccag
tcccaaccacagcttgtttctgccacttccaatggtcgtcaagttgttgctttaatgacc
caccaaaatattcctcatacaaatgtatctgatccaggagcccctttacgtgattctggt
tccaataattctgctaataaccttggcaacggcatacaatga

DBGET integrated database retrieval system