KEGG   Schistosoma mansoni: Smp_106150Help
Entry
Smp_106150        CDS       T01095                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2 3.5.2.3 6.3.5.5)
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
smm  Schistosoma mansoni
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:smm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:smm00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 1370 aa AA seqDB search
MVLGSGVYRIGSSVEFDWCAVGCVKELRRLGWKTVIINCNPETVSTDFDMCDRLYFDELS
LERVLDIYEFESPIGVIVSMGGQTPNNIAMPMHRLGVPILGTSAESIDNAENRFKFSRLL
DCIGLSQPRWKELTDIDSAKAFCEEVGYPCLVRPSYVLSGAAMNVANDHDQLITFLTAAK
NISPEHPVVISQFILDAKEIDVDAVAQSGRLVAMAVSEHVENAGVHSGDATLVTPPQDLN
EETLKLIKELVRALADELEVSGPFNLQLLAKDNRLLIIEANLRVSRSFPFVSKTLKYDFI
AAATRAILGAARDSIHPPFDTPNSKLEKLSLSKSFLEPSVNILENTIGYVGVKVPVFSFA
RLLGADVLLGVEMVSTGEVACFGVDRYEAYLLAQAAALCNTNGLLPKPGDNVFLSIGSYR
HKLEMLPSVKQLHQLGYKLYGSCGTADFYQTQGISIIPVEWPYEESDICISDNKIQNNMD
ASSKDGTIQQYLKDKLFSLIVSLSLKKVGSRRLSAFVTRGYQTRRLAVDTNVPLLTDVKL
AKLLIEALYRYFHGQSANKTLIKSEDNEYNVYKQSFLHRLLPLHSITSSQIIYLPGLIDI
HVHTRDPGMEYKEDWTSVTKAALAGGIVTILAMPNTDPAIVDENTFNIMSRNAASKACCD
YGLYVGASSENAFTVSSLSHKAVGLKMYLNETFTCLSLGNKLNIWRQHFENWPSDRPICC
HAEGETIAAVILLAEITGRSVHICHVARRAEIELIRDAKQRGLKVTCEVCPHHLFLTADD
LPQEGGWNEVRPRLGTADDINALWANISTIDCFATDHAPHTISEKSKVSGAPPGFPGLET
MLSLLLTAMYNGRLTLTELIERLYINPYKIFGIPTAHTLYEAVNSVSRGIYGETWVEVDM
SAEWRIPGAAWKTKSESEPSFFTRANWSPFAGRVVRGQVRRVMLRGHLAFVDGRVLVEPG
FGKDVSSDISLSKNSYDPLTIDTSLKHIPVSAGSPTLRNRYSSTNERVQSQDEPGTPIPA
NTQSDEGPRSPIIVYQPSASGLIPTAQLPQTHQSLPSIWLEGISGKHILSSEDFSKDHLR
RLYNLAHSFKVALNKNKPLDQICRGKVMGNLFFEPSTRTSNSFAVAMQRLGGTVVHFSES
TSSQTKGETTLDTVRILAGYCDCLVIRHPGKGAIQALANSIVHKPIINAGDGIGEHPTQA
LLDVFTIREEIGTVNGLTITMVGDLANGRTVHSLARLLCLYKVKLRYVTHRDEFKMPPEV
KSYVADRGIPQEEMTSLEEALPDTDVLYMTRVQTERMSDDGNARRDQFVVTPELMTLAKP
RGMIVMHPLPRVGEISPKFDSDPRAAYFRQAEYGTHVRMALLAIVLANQK
NT seq 4113 nt NT seq  +upstreamnt  +downstreamnt
atggttcttggctctggagtttatcgtattggctctagtgttgaattcgactggtgcgct
gtcggttgtgtcaaggaacttcgacgcttaggatggaaaacagttatcatcaactgtaat
cccgaaactgtatcaactgattttgatatgtgtgaccgactctattttgatgaactatct
cttgaacgtgttctagatatatatgaattcgaatcacccataggtgttatcgttagcatg
ggtggccaaacaccaaataatatcgctatgccaatgcatcgtttaggtgtacctattctc
ggcacaagtgctgagtccattgacaatgctgaaaatcgtttcaagttttcacgtttgtta
gactgtatcgggttgtcacagcctagatggaaagaactcactgatattgattcagccaag
gccttctgtgaagaagtcggttacccgtgtctcgttcgaccaagctacgtgttatctggt
gctgctatgaatgttgcaaacgatcatgatcaattaattacattcctgactgccgcaaaa
aatattagtccagaacacccagttgttataagtcaatttattttggatgccaaagaaata
gatgttgatgctgttgcacaatctggtcgtctagttgcaatggctgtctctgaacatgtt
gagaatgctggtgttcattcaggtgatgcaacacttgtcacaccccctcaagacctcaac
gaagaaactctgaaacttatcaaagaactagttcgagctttggcagatgaactcgaagta
tcgggtccattcaacctacaacttcttgctaaagacaatcgtcttctaatcatagaagca
aacttaagagtctcccgttcttttccatttgtatctaaaacacttaagtatgatttcata
gcagctgctacacgagccattcttggtgcagcacgtgattccattcatcccccatttgat
acgcctaattcaaagctggaaaaattgtccctatccaagtcctttcttgagccatctgtc
aacattttggagaacactataggatatgttggtgtaaaggttccggtattctctttcgca
cgccttttgggtgctgatgttttgttgggtgtcgaaatggtcagtactggtgaagtagca
tgttttggtgttgatcgctatgaagcctatctcttagcacaagctgctgcattatgtaat
acaaatggactccttcctaaaccaggtgataatgtattcttatctataggaagttatcgt
cataaattggaaatgcttccaagtgttaaacagttacaccaacttggatacaaattatac
ggaagttgtggaactgctgacttctatcaaactcaaggcatttctatcatcccagtggaa
tggccttacgaagaatcagatatatgcatttctgataataaaattcaaaataatatggat
gcaagttcaaaagacggtacaattcagcaatatcttaaagataaactgttttcattgatt
gttagtttatcattgaaaaaagtgggatctcgacgtctttcagcctttgttacacgtggc
tatcaaactagacgtcttgccgttgacacaaacgtacctcttctaactgatgtaaaactg
gctaaacttcttatcgaagctctttatcgttattttcatggacagagtgctaataaaaca
ttaataaaatctgaagacaatgaatataacgtatataagcaatcattccttcatcgttta
cttccattgcattcaataacttctagtcaaataatatatttgccaggtttgatcgatatt
cacgtccacaccagggatcccggaatggaatataaggaggactggacatctgttactaaa
gctgcgcttgcaggtggtatagtaactattttagcaatgccaaacactgatcctgcaata
gttgatgaaaatacctttaacattatgagcagaaatgcagcatctaaagcgtgttgtgat
tatggtctttatgttggcgcatcatcagaaaatgctttcactgttagttctctatctcac
aaagctgttggactcaaaatgtatcttaatgaaacatttacttgcttatcgttaggcaat
aagcttaatatttggcgtcaacattttgaaaactggccaagtgatcgtccaatttgttgc
catgctgaaggtgaaaccattgccgctgtaattcttttagcggaaatcactggacgcagt
gtgcatatttgtcatgttgcacgtagagctgaaattgaattaattcgtgatgcgaaacaa
cgtggtctaaaggtcacatgtgaagtttgtccacatcatttattcttaactgcagatgat
ttacctcaagaaggaggttggaatgaagtgcgcccacgactcggtacagcagatgatata
aacgctctttgggccaacattagcacaatcgattgtttcgcaactgatcatgcaccacac
actatttctgaaaagagtaaagtgtcaggggcacctcctggatttccaggtttggaaaca
atgttgtcgttgttactgaccgctatgtataatggccgtcttacgcttactgaactgatt
gaacgcctgtatataaatccatacaaaatatttgggataccaactgctcacactttatat
gaagctgtaaactcagttagtcgggggatatatggcgaaacatgggttgaagtggatatg
agtgctgaatggcgtattcctggggctgcatggaaaaccaagtcagaatctgaaccttca
ttctttactcgtgctaattggagccctttcgccggcagagttgttcgtggtcaagttcgt
cgggtcatgctccgaggtcatctagcatttgtcgatggacgtgtcttggtagagcctggt
ttcggtaaagatgtgtcgtcagacatatccttgtccaagaattcttacgacccactaaca
attgacacttctttgaaacatatccctgtctcagctggttctcccactctaagaaaccgg
tatagttcaactaatgaacgtgttcagtctcaagatgaacctggtacaccgatcccagct
aacactcaaagtgatgagggacctcgtagtccaattattgtataccaaccttctgcatct
ggtttgattccaactgcccaactacctcaaactcaccaaagtcttccaagtatatggtta
gaaggtatatcagggaagcatatactttcttctgaggatttctcaaaagatcatcttcgt
cggttgtataatttagcacatagttttaaagttgctctaaacaaaaacaaacctttagat
cagatatgccgtggaaaagtaatggggaatctgttttttgagccaagtacgcgtacttct
aattcatttgctgtagcaatgcaacgactgggtggcactgtagtgcatttttcagaatct
accagctcccagacaaaaggtgaaactactttagatactgtacggatattagccggttat
tgtgattgcttggtaattaggcatcctggaaaaggtgctatacaagctttagcaaattca
atagtacacaaaccaattataaatgcaggcgatgggataggcgagcatcctactcaggca
ttactcgatgttttcacaattagagaggagatcgggacagtgaatggtctaactatcact
atggtcggagatctcgctaatggacgcacagtacatagtttggctcgattattatgttta
tataaagtcaaactacgttacgtcactcacagagatgaattcaagatgccaccagaagtt
aaatcgtatgttgctgatcgtggtattccacaagaagagatgactagcttggaggaggca
ctacctgataccgatgtcctctacatgacacgtgtgcaaacagagagaatgagtgatgat
ggaaatgcccggcgtgatcagttcgttgtcacacctgaactgatgacactagccaagcct
agaggaatgattgtaatgcacccactacctcgtgttggagaaatcagccccaaatttgat
tctgaccctcgagcagcttacttccgtcaagcggagtatggaacgcatgttcgcatggcc
ctcctggctatagtgctggctaatcagaaatga

DBGET integrated database retrieval system